DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amd and GAD1

DIOPT Version :9

Sequence 1:NP_476592.1 Gene:amd / 35188 FlyBaseID:FBgn0000075 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_000808.2 Gene:GAD1 / 2571 HGNCID:4092 Length:594 Species:Homo sapiens


Alignment Length:523 Identity:133/523 - (25%)
Similarity:217/523 - (41%) Gaps:99/523 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EFGKAAIDYIADYLENI--RDDDVLPNVEPGYLLDLLP---TEMPEEPEAWKDVLGDISRVIKPG 67
            :|....:|.:.:|:...  |...||....|..||:.:.   .|:.:.||:.:.:|.|....:|  
Human   115 QFLLEVVDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLK-- 177

  Fly    68 LTHWQSPHMHAYYPTSTSYPSIVGEMLASGFGVIGFS--WICSPACTEL---EV----VVMDWLA 123
                        |...|.:|....: |::|..:||.:  |:.|.|.|.:   |:    |:|:.:.
Human   178 ------------YGVRTGHPRFFNQ-LSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQIT 229

  Fly   124 KFLKLPAHFQHASDGPGGGVIQGSASEAVLVAVLAAREQAVANYRESHPELSESEVRG-----RL 183
              ||........|...|.|:.....:.:.:.:::|||          :....|.:.:|     :|
Human   230 --LKKMREIVGWSSKDGDGIFSPGGAISNMYSIMAAR----------YKYFPEVKTKGMAAVPKL 282

  Fly   184 VAYSSDQSNSCIEKAGVLAAMPIRLLPAGEDFVL------RGDTLRGAIE----EDVAAGRIPVI 238
            |.::|:||:..|:|||.       .|..|.|.|:      ||..:....|    |....|.:|..
Human   283 VLFTSEQSHYSIKKAGA-------ALGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFY 340

  Fly   239 CVATLGTTGTCAYDDIESLSAVCEEFKVWLHVDAAYAGGAFALEECSDLRKGLDRVDSLNFNLHK 303
            ..||.|||...|:|.|:.::.:||::.:|||||||:.||.....:......|::|.:|:.:|.||
Human   341 VNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHK 405

  Fly   304 FMLVNFDCSAMWLRD------ANKVVDS--FNVDRIYLKHKHEGQSQIPDFRHWQIPLGRRFRAL 360
            .|.|...|||:.:::      .|::...  |..|:.|......|...|...||..|        .
Human   406 MMGVLLQCSAILVKEKGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDI--------F 462

  Fly   361 KVWITFRTLGAEGLRNHVRKHIELAKQFEQLVLKDSRFELV---APRALGLVCF-------RPKG 415
            |.|:.::..|..|..|.:.|.:|||:.....:.....||:|   .|.... |||       |...
Human   463 KFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMVFNGEPEHTN-VCFWYIPQSLRGVP 526

  Fly   416 DNEITTQLLQRLMDRKKIYMVKA--EHAGRQ-------FLRFVVCGMDTKASDIDFAWQEIESQL 471
            |:....:.|.::..:.|..|:::  ...|.|       |.|.|:.......|||||..:|||...
Human   527 DSPQRREKLHKVAPKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLG 591

  Fly   472 TDL 474
            .||
Human   592 QDL 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amdNP_476592.1 Pyridoxal_deC 35..414 CDD:278699 108/423 (26%)
GAD1NP_000808.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Pyridoxal_deC 144..518 CDD:365998 107/416 (26%)
Substrate binding 190..192 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.