DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amd and Csad

DIOPT Version :9

Sequence 1:NP_476592.1 Gene:amd / 35188 FlyBaseID:FBgn0000075 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001346055.1 Gene:Csad / 246277 MGIID:2180098 Length:493 Species:Mus musculus


Alignment Length:493 Identity:118/493 - (23%)
Similarity:195/493 - (39%) Gaps:99/493 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPGYLLDLLPTEMPEEPEAWKDVLGDISRVIKPGLTHWQSPHMHAYYPTSTSYP----------- 87
            ||..|..||..|:..:.|:.:.:|.....||              :|...|.:|           
Mouse    48 EPEELKQLLDLELQSQGESREQILERCRTVI--------------HYSVKTGHPRFFNQLFSGLD 98

  Fly    88 --SIVGEMLASGFGVIGFSWICSPACTELEVVVMDWLAKFLKLPAHFQHASDG---PGGGVIQGS 147
              ::.|.::........:::..:|....:|..|:..|...:.     .::.||   |||.:    
Mouse    99 PHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVG-----WNSGDGVFCPGGSI---- 154

  Fly   148 ASEAVLVAVLAAREQAVANYRESHPELSESEVRG--RLVAYSSDQSNSCIEKAGV---LAAMPIR 207
               :.:.|:..||.|       .:|:..:..:|.  .|..::|.:.:..|.|...   |....:|
Mouse   155 ---SNMYAMNLARFQ-------RYPDCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVR 209

  Fly   208 LLPAGEDFVLRGDTLRGAIEEDV----AAGRIPVICVATLGTTGTCAYDDIESLSAVCEEFKVWL 268
            ::.|.|    ||..:...:|..:    |.|.:|.:..||.|||...|:|.:::::.||:...:|.
Mouse   210 VVKADE----RGRMIPEDLERQIILAEAEGSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWF 270

  Fly   269 HVDAAYAGGAFALEECSDLRKGLDRVDSLNFNLHKFMLVNFDCSAMWLRDANKVVDSFNVDRIYL 333
            |||||:.|..........|..|:.|.||:.:|.||.:.....|||:.|||.:.:          |
Mouse   271 HVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNL----------L 325

  Fly   334 KHKHEGQSQ--IPDFRHWQIPL---------GRRFRALKVWITFRTLGAEGLRNHVRKHIELAKQ 387
            |..|..|:.  ....:.:.:.|         |||...||:|:.::..|.:||...:.:...|.:.
Mouse   326 KRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAFALTRY 390

  Fly   388 FEQLVLKDSRFELVAPRALGLVCF-------RPKGDNEITTQLLQRLMDRKKIYMVK-------- 437
            ..:.:.|...||||.......|||       |.|.::...:|.|.::....|..|||        
Mouse   391 LVEEIKKREGFELVMEPEFVNVCFWFVPPSLRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGY 455

  Fly   438 AEHAGR-QFLRFVVCGMDTKASDIDFAWQEIESQLTDL 474
            ..|..| .|.|.||.......:||||...|:|....||
Mouse   456 QPHGTRANFFRMVVANPILAQADIDFLLGELELLGQDL 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amdNP_476592.1 Pyridoxal_deC 35..414 CDD:278699 96/421 (23%)
CsadNP_001346055.1 DOPA_deC_like 89..481 CDD:99743 99/424 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.