DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amd and Gad2

DIOPT Version :9

Sequence 1:NP_476592.1 Gene:amd / 35188 FlyBaseID:FBgn0000075 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_036695.1 Gene:Gad2 / 24380 RGDID:2653 Length:585 Species:Rattus norvegicus


Alignment Length:512 Identity:127/512 - (24%)
Similarity:220/512 - (42%) Gaps:96/512 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IDYIADYLENIRDDDVLPNVEPGYLLDLLPTEMPEEPEAWKDVLGDISRVIKPGLTHWQSPHMHA 78
            :.|:....:  |...|:....|..||.....|:.::|:..:::           |||.|:.   .
  Rat   119 LQYVVKSFD--RSTKVIDFHYPNELLQEYNWELADQPQNLEEI-----------LTHCQTT---L 167

  Fly    79 YYPTSTSYPSIVGEMLASGFGVIGFS--WICSPACTE------------LEVVVMDWLAKFLKLP 129
            .|...|.:|....: |::|..::|.:  |:.|.|.|.            ||.|.:..:.:.:..|
  Rat   168 KYAIKTGHPRYFNQ-LSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWP 231

  Fly   130 AHFQHASDGPGGGVIQGSASEAVLVAVLAAREQAVANYRESHPELSESEVRG--RLVAYSSDQSN 192
            .       |.|.|:.....:.:.:.|:|.||      |: ..||:.|..:..  ||:|::|:.|:
  Rat   232 G-------GSGDGIFSPGGAISNMYAMLIAR------YK-MFPEVKEKGMAAVPRLIAFTSEHSH 282

  Fly   193 SCIEKAGVLAAMPIRLLPAGEDFVL------RGDTLRGAIEEDV----AAGRIPVICVATLGTTG 247
            ..::|..  ||:.|     |.|.|:      ||..:...:|..:    ..|.:|.:..||.|||.
  Rat   283 FSLKKGA--AALGI-----GTDSVILIKCDERGKMIPSDLERRILEVKQKGFVPFLVSATAGTTV 340

  Fly   248 TCAYDDIESLSAVCEEFKVWLHVDAAYAGGAFALEECSDLRKGLDRVDSLNFNLHKFMLVNFDCS 312
            ..|:|.:.:::.:|:::|:|:|||||:.||.....:......|::|.:|:.:|.||.|.|...||
  Rat   341 YGAFDPLLAVADICKKYKIWMHVDAAWGGGLLMSRKHKWKLNGVERANSVTWNPHKMMGVPLQCS 405

  Fly   313 AMWLRDAN--KVVDSFNVDRIYLKHKHEGQSQIPDFRHWQIPLGRRFRALKVWITFRTLGAEGLR 375
            |:.:|:..  :..:..:...::.:.||...|.  |.....:..||.....|:|:.:|..|..|..
  Rat   406 ALLVREEGLMQSCNQMHASYLFQQDKHYDLSY--DTGDKALQCGRHVDVFKLWLMWRAKGTTGFE 468

  Fly   376 NHVRKHIELAKQFEQLVLKDSRFELV---APRALGLVCF-------RPKGDNE--------ITTQ 422
            .|:.|.:|||:....::.....:|:|   .|:... |||       |...|||        :...
  Rat   469 AHIDKCLELAEYLYNIIKNREGYEMVFDGKPQHTN-VCFWFVPPSLRVLEDNEERMSRLSKVAPV 532

  Fly   423 LLQRLMDRKKIY---MVKAEHAGRQ--FLRFVVCGMDTKASDIDFAWQEIESQLTDL 474
            :..|:|:    |   ||..:..|.:  |.|.|:........||||..:|||....||
  Rat   533 IKARMME----YGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amdNP_476592.1 Pyridoxal_deC 35..414 CDD:278699 103/416 (25%)
Gad2NP_036695.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Pyridoxal_deC 138..509 CDD:278699 102/409 (25%)
Substrate binding. /evidence=ECO:0000250 181..183 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.