DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amd and Sgpl1

DIOPT Version :9

Sequence 1:NP_476592.1 Gene:amd / 35188 FlyBaseID:FBgn0000075 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001303602.1 Gene:Sgpl1 / 20397 MGIID:1261415 Length:568 Species:Mus musculus


Alignment Length:384 Identity:70/384 - (18%)
Similarity:131/384 - (34%) Gaps:115/384 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 EMLASGFGVIGFSWI------CSPACTELEVVVMDWLAKFLKLPAHFQHASDGPGG-GVIQGSAS 149
            |:|...:|  .|:|.      ..|...:||..::.......         :.||.. |.:....:
Mouse   158 ELLVQAYG--EFTWSNPLHPDIFPGLRKLEAEIVRMTCSLF---------NGGPDSCGCVTSGGT 211

  Fly   150 EAVLVAVLAAREQAVANYRESHPELSESEVRGRLVAYSSDQSNSCIEKAGVLAAMPIRLLPAGED 214
            |::|:|..|.|:.|:....:: ||:           .:.:.:::..:||.....|.|..:...::
Mouse   212 ESILMACKAYRDLALEKGIKT-PEI-----------VAPESAHAAFDKAAHYFGMKIVRVALKKN 264

  Fly   215 FVLRGDTLRGAIEEDVAAGRIPVICVATLGTTGTCAYDDIESLSAVCEEFKVWLHVDAAYAG--- 276
            ..:....::.||..:.|.    ::|.......|  ..|.:..::.:...:|:.|||||...|   
Mouse   265 MEVDVQAMKRAISRNTAM----LVCSTPQFPHG--VMDPVPEVAKLAVRYKIPLHVDACLGGFLI 323

  Fly   277 -----GAFALEECSDLR-KGLDRVDSLNFNLHKFMLVNFDCSAMWLRDANKVVDSFNVDRIYLKH 335
                 ..:.||:..|.| ||   |.|::.:.||:         .:....:.||       :|...
Mouse   324 VFMEKAGYPLEKPFDFRVKG---VTSISADTHKY---------GYAPKGSSVV-------MYSNE 369

  Fly   336 KHEGQSQIPDFRHWQIPLGRRFRA-----------------LKVWITFRTLGAEGLRNHVRKHIE 383
            |         :|.:|..:|..::.                 ...|......|..|       ::|
Mouse   370 K---------YRTYQFFVGADWQGGVYASPSIAGSRPGGIIAACWAALMHFGENG-------YVE 418

  Fly   384 LAKQFEQLVLKDSRF---EL--------VAPRALGLVCFRPKGDNEITTQLLQRLMDRK 431
            ..||    ::|.:||   ||        .....|.::..   |.|:.....|..:|..|
Mouse   419 ATKQ----IIKTARFLKSELENIKNIFIFGDPQLSVIAL---GSNDFDIYRLSNMMSAK 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amdNP_476592.1 Pyridoxal_deC 35..414 CDD:278699 65/365 (18%)
Sgpl1NP_001303602.1 DOPA_deC_like 146..507 CDD:99743 70/384 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.