DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amd and sgpl1

DIOPT Version :9

Sequence 1:NP_476592.1 Gene:amd / 35188 FlyBaseID:FBgn0000075 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_005156777.1 Gene:sgpl1 / 100037312 ZFINID:ZDB-GENE-070410-24 Length:574 Species:Danio rerio


Alignment Length:408 Identity:84/408 - (20%)
Similarity:142/408 - (34%) Gaps:123/408 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GLTHWQSPHMHAYYPTSTSYPSIVG--------------EMLASGFGVIGFSWI------CSPAC 111
            ||||.|.......|.|.:......|              ::|...:|  .|:|.      ..|..
Zfish   117 GLTHKQLLDKIREYETLSEVNWAKGKVSGAVYWGDEKLTDLLVKVYG--EFAWTNPLHPDIFPGV 179

  Fly   112 TELEV-VVMDWLAKFLKLPAHFQHASDGPGG-GVIQGSASEAVLVAVLAAREQAVANYRE-SHPE 173
            .::|. ||....|.|          :.||.. |.:....:|::|:|..|.|:  :|:.|. .|||
Zfish   180 RKMEAEVVRMTCALF----------NGGPDSCGTVTSGGTESILMACKAYRD--MAHERGIKHPE 232

  Fly   174 LSESEVRGRLVAYSSDQSNSCIEKAGVLAAMPIRLLPAGEDFVLRGD--TLRGAIEEDVAAGRIP 236
                     ::|..|  .::..:||.....|.:..:|. ::..::.|  .:|.||.::.|.    
Zfish   233 ---------IIAPIS--VHAAFDKAAHYFGMKLIHVPL-DNKTMKVDVKAMRRAITKNTAM---- 281

  Fly   237 VICVATLGTTGTCAYDDIESLSAVCEEFKVWLHVDAAYAGGAFALEECSDLRKGLDRVDSLNFNL 301
            ::|.|.....|  ..|.:|.::.:..::.:..||||...|......|    :.|           
Zfish   282 LVCSAPQFPHG--IMDPVEEVAKLAVKYNIPFHVDACLGGFLIVFME----KAG----------- 329

  Fly   302 HKFMLVNFDCSAMWLRDANKVVDSFNVDRIYLKHKH----EGQSQI----PDFRHWQIPLGRRFR 358
              |.|..||...       |.|.|.:.|    .||:    :|.|.:    ..|||:|..:...::
Zfish   330 --FKLAPFDFRV-------KGVTSISAD----THKYGYAPKGSSVVLYSNRKFRHYQYFVAPDWQ 381

  Fly   359 A-----------------LKVWITFRTLGAEGLRNHVRKHIELAKQFEQLVLKDSRFELVAPRAL 406
            .                 ...|.|...:|.:|.....||.:|..::.:..:.|..          
Zfish   382 GGIYASPSMAGSRPGGIIAACWATMMHMGEKGYVEATRKVVETTRKIKTGIRKID---------- 436

  Fly   407 GLVCFRPKGDNEITTQLL 424
            |:..|   ||.|::...|
Zfish   437 GVFVF---GDPEVSVVAL 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amdNP_476592.1 Pyridoxal_deC 35..414 CDD:278699 80/396 (20%)
sgpl1XP_005156777.1 DOPA_deC_like 143..504 CDD:99743 76/382 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.