DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17344 and IKZF3

DIOPT Version :9

Sequence 1:	NP_609943.1	Gene:	CG17344 / 35185	FlyBaseID:	FBgn0032755	Length:	154	Species:	Drosophila melanogaster
Sequence 2:	NP_036613.2	Gene:	IKZF3 / 22806	HGNCID:	13178	Length:	509	Species:	Homo sapiens

Alignment Length:	123	Identity:	21/123 - (17%)
Similarity:	46/123 - (37%)	Gaps:	35/123 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly    34 IRLLAARSDLAMTPWSLPSESPSESDESESQISGYTTESSYRTVPGYELLSQSSSYASRQNPYAY 98
            :.::::...:|:|...:.:.:|.|.::....:       ..::||....||
Human   335 VPVISSMYPIALTRAEMSNGAPQELEKKSIHL-------PEKSVPSERGLS-------------- 378

  Fly    99 PPADFLWEIYVPIHSGATEEDIQTVHGELRELLASEMHLI--RGANG-PVIYLIAYSY 153
                       |.:||....|..:.|.|.:..:..:.|::  |..|| |::..:..||
Human   379 -----------PNNSGHDSTDTDSNHEERQNHIYQQNHMVLSRARNGMPLLKEVPRSY 425

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17344	NP_609943.1	None
IKZF3	NP_036613.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..86
		COG5048	<79..>219	CDD:227381
		C2H2 Zn finger	120..140	CDD:275368
		zf-H2C2_2	133..157	CDD:316026
		C2H2 Zn finger	148..168	CDD:275368
		C2H2 Zn finger	176..196	CDD:275368
		C2H2 Zn finger	204..220	CDD:275368
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	364..394		8/61 (13%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S3834
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.950