DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim3 and lhx2a

DIOPT Version :9

Sequence 1:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_017208320.1 Gene:lhx2a / 795283 ZFINID:ZDB-GENE-091118-109 Length:328 Species:Danio rerio


Alignment Length:347 Identity:105/347 - (30%)
Similarity:151/347 - (43%) Gaps:100/347 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 PKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDK--CFARNGQLFCKEDFFKR--YGTK 180
            |.|.||..||.|||.|...||.||.:||:||.|...|..:  ||:::|.::||||::.|  ...:
Zfish    11 PVCAGCGALISDRFYLLAAERRWHERCLKCSACQTDLESELTCFSKHGDIYCKEDYYSRRFSSQR 75

  Fly   181 CSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYE-EAKAKGL 244
            |:.|.:||..|::|.||:|.||||.||.||.|.:.|.|||. |.|::..:.|:...: |..|...
Zfish    76 CARCHLGISATEIVMRARDLVYHLSCFSCATCHKVLLTGDH-YGMKETSVYCRAHIQRECHADLY 139

  Fly   245 YLDGS----------LDGDQP---------------------------------------NKRPR 260
            |.|.|          .|.:.|                                       :||.|
Zfish   140 YSDMSSRETNSESHTYDEESPVHRARVRRRKNNSTADHIAYSSDVSDLGVDLSERVSCQKSKRMR 204

  Fly   261 TTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQ 325
            |:....||.::::.:.::..|.....::|:|.|||..||:||||||.|||.:|            
Zfish   205 TSFKHHQLRSMQSFFTHNHNPDAKDLKELAQKTGLTKRVLQVWFQNARAKFRR------------ 257

  Fly   326 YFRSMKGNCSPRTDKFLDKDELKVDYDSFSHHDLSNDSYSTVNLGLDEGASPHSIRGSYMHGS-- 388
                   ||       |.::.:.||       ::|::|..|         ||........|||  
Zfish   258 -------NC-------LYQESIGVD-------NVSDNSTLT---------SPSVPSPELCHGSMS 292

  Fly   389 -SSPSQYPPSSRSPPPVGQGHT 409
             ||||...||..:|......|:
Zfish   293 PSSPSGTSPSQHTPSAARNTHS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754 25/52 (48%)
LIM2_Lhx3_Lhx4 181..236 CDD:188762 25/54 (46%)
Homeobox 259..312 CDD:278475 21/52 (40%)
lhx2aXP_017208320.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.