DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim3 and zfhx2

DIOPT Version :9

Sequence 1:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_001335082.5 Gene:zfhx2 / 795005 ZFINID:ZDB-GENE-030131-6699 Length:1529 Species:Danio rerio


Alignment Length:270 Identity:67/270 - (24%)
Similarity:100/270 - (37%) Gaps:95/270 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 KRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRT 321
            :||||.:|:.||..|::.|.....|.....|.:..:.||.::|||:||||.|||||         
Zfish  1341 RRPRTHLTSLQLSILQSCYETCAHPNALECEAVGTELGLPLKVVQIWFQNTRAKEK--------- 1396

  Fly   322 RWSQYFRSMKGNCSPRTDKFLDKDELKVDYDSFSHHDLSNDSYSTVN-LGLDEGASPHSIRGSYM 385
            ||......|..|.|..:.|.                |:|:.||...| |..:....|..::.:.:
Zfish  1397 RWRLQQEKMSPNPSDPSKKI----------------DVSSGSYLQYNALRANRPILPKPVQLTVV 1445

  Fly   386 HGSSSPSQYPPSSRSPPPVGQGHTFGSYPDNIVYTNIDQ-------AVGSSLHASKAHHRLH--S 441
                          .|.|        ||  ||..|.:.:       |.|:... |:|..|.|  |
Zfish  1446 --------------DPAP--------SY--NIGQTTVRETLIGKCDACGAEFE-SRAAARDHVFS 1485

  Fly   442 SNNVSDLSNDSSPDQGYPDFPPSPDSWLGDSGSTNTTSANNNANNNSSSSHNNNNSSGGGSGG-V 505
            :.:::.|                           .||:....|:..|       |.||.||.| :
Zfish  1486 ARHLATL---------------------------RTTNFGLQASMVS-------NGSGTGSVGII 1516

  Fly   506 SVSTAPNPSA 515
            |.|:.|:|::
Zfish  1517 SQSSTPSPAS 1526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754
LIM2_Lhx3_Lhx4 181..236 CDD:188762
Homeobox 259..312 CDD:278475 22/52 (42%)
zfhx2XP_001335082.5 C2H2 Zn finger 171..193 CDD:275368
C2H2 Zn finger 223..241 CDD:275368
Homeobox 1039..1090 CDD:278475
HOX 1340..1396 CDD:197696 23/54 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1174754at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.