DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim3 and lhx6b

DIOPT Version :9

Sequence 1:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_685757.5 Gene:lhx6b / 557579 ZFINID:ZDB-GENE-060531-41 Length:286 Species:Danio rerio


Alignment Length:287 Identity:97/287 - (33%)
Similarity:147/287 - (51%) Gaps:49/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 CGGCHELILDRFILKVLERTWHAKCLQCSECHGQL--NDKCFARNGQLFCKEDFFKRYGTKCSAC 184
            |.||...|.||::|||...|||.:|||||.|...|  .:.||.||.::||:.|:...:|.||:.|
Zfish    33 CTGCSTEIFDRYVLKVNGLTWHLRCLQCSVCAVSLGHQNSCFIRNKEIFCRTDYNSTFGIKCARC 97

  Fly   185 DMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDY-------EEAKAK 242
            ...:.....:|||.:::|||.||.|..|.|.|:||:||.|||: :::|:..|       ::....
Zfish    98 GHQVSANDWIRRAGNDIYHLACFACFFCKRQLSTGEEFGLMEN-QVLCRVHYDITLLNLQQLSDN 161

  Fly   243 G--LYLDGSLDGD---QPNKRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQV 302
            |  ::|||:|...   :.:|||||:.|::|::.::|.:.....|.....::|:..|||..||:||
Zfish   162 GNLIHLDGALPIQYLPKASKRPRTSFTSEQIQIMQTHFIRDKNPDAATLQRLADTTGLSRRVIQV 226

  Fly   303 WFQNRRAKEKRLKKDAGRTRWSQYFRSMKGNCSPRTDKFLDKDELKVDYDSFSHHDLSNDSYSTV 367
            ||||.||::||:                     |..|...::|..:.....|. .|||:.|.|.|
Zfish   227 WFQNCRARQKRI---------------------PLHDSIPERDRYQTSAMPFL-SDLSSTSCSQV 269

  Fly   368 NLGLDEGASPHSIRGSYMHGSSSPSQY 394
            :|.|.            |..:|.|..|
Zfish   270 DLSLS------------MISASDPIHY 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754 25/52 (48%)
LIM2_Lhx3_Lhx4 181..236 CDD:188762 22/54 (41%)
Homeobox 259..312 CDD:278475 21/52 (40%)
lhx6bXP_685757.5 LIM 32..86 CDD:295319 25/52 (48%)
LIM 94..148 CDD:295319 22/54 (41%)
Homeobox 183..236 CDD:278475 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.