DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim3 and CRIP3

DIOPT Version :9

Sequence 1:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_996805.2 Gene:CRIP3 / 401262 HGNCID:17751 Length:204 Species:Homo sapiens


Alignment Length:159 Identity:33/159 - (20%)
Similarity:46/159 - (28%) Gaps:63/159 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 CGGCHELILDRFILKV--LERTWHAKCLQCSECHGQLNDKCFA-RNGQLFC-KEDFFKRYG---- 178
            |..|.:.:.  |..||  |.:.||..||:|..||..|:....| .||:.:| |..:...:|    
Human     5 CPRCQQPVF--FAEKVSSLGKNWHRFCLKCERCHSILSPGGHAEHNGRPYCHKPCYGALFGPRGV 67

  Fly   179 -------------TKCSACDMGIPP----------------------------TQVVRRAQDNVY 202
                         |....|...:.|                            |.:.....:.||
Human    68 NIGGVGSYLYNPPTPSPGCTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGETSLCPGCGEPVY 132

  Fly   203 ------------HLQCFLCAMCSRTLNTG 219
                        |..|..|..|.:||..|
Human   133 FAEKVMSLGRNWHRPCLRCQRCHKTLTAG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754 19/54 (35%)
LIM2_Lhx3_Lhx4 181..236 CDD:188762 12/79 (15%)
Homeobox 259..312 CDD:278475
CRIP3NP_996805.2 LIM1_TLP 5..58 CDD:188860 19/54 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..112 2/27 (7%)
LIM2_TLP 124..177 CDD:188861 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.