DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim3 and LMX1B

DIOPT Version :9

Sequence 1:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001167617.1 Gene:LMX1B / 4010 HGNCID:6654 Length:406 Species:Homo sapiens


Alignment Length:409 Identity:126/409 - (30%)
Similarity:167/409 - (40%) Gaps:122/409 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 CGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFKRYGTKCSACDM 186
            |.||...|.|||:::|.|.:||.:||||:.|...|...|:.|:.:|:||:|:.:.:..|||.|..
Human    56 CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCME 120

  Fly   187 GIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYEE------------- 238
            .|.||:.|.||.:.||||.||.|.:|.|.|..||||.|.|. :|:||.|||:             
Human   121 KIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEG-QLLCKGDYEKEKDLLSSVSPDES 184

  Fly   239 --------------AKAKGLYLDGS-LDGDQPN--KRPRTTITAKQLETLKTAYNNSPKPARHVR 286
                          ||.:|....|| .||..|.  |||||.:|.:|....|.::..|.||.|.||
Human   185 DSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVR 249

  Fly   287 EQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSMKGNCSPRTDKFLDKDELKVDY 351
            |.|:.:|||.:|||||||||:|||.|:|.:                                   
Human   250 ETLAAETGLSVRVVQVWFQNQRAKMKKLAR----------------------------------- 279

  Fly   352 DSFSHHDLSNDSYSTVNLGLDE-------GASPHSIRGSYMHGSSSPSQYPPSSR---------- 399
                .|....:..::..||..|       |....|.|...|..|.:|.. ||..:          
Human   280 ----RHQQQQEQQNSQRLGQGEPGPGQGLGQEVLSSRMEGMMASYTPLA-PPQQQIVAMEQSPYG 339

  Fly   400 SPPPVGQGHTFGSYPDNIVYTNIDQAVGSSLHASKAHHRLHSSNNVSDLSNDSSPDQGYPDFPPS 464
            |..|..||.|....|.|                ....|.:.|..:::.||               
Human   340 SSDPFQQGLTPPQMPGN----------------DSIFHDIDSDTSLTSLS--------------- 373

  Fly   465 PDSWLG--DSGSTNTTSAN 481
             |.:||  |.||......|
Human   374 -DCFLGSSDVGSLQARVGN 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754 22/50 (44%)
LIM2_Lhx3_Lhx4 181..236 CDD:188762 28/54 (52%)
Homeobox 259..312 CDD:278475 29/52 (56%)
LMX1BNP_001167617.1 LIM1_Lmx1b 56..108 CDD:188757 23/51 (45%)
LIM2_Lmx1a_Lmx1b 115..169 CDD:188764 28/54 (52%)
Homeobox 222..275 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.