DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim3 and Lmo4

DIOPT Version :9

Sequence 1:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001009708.1 Gene:Lmo4 / 362051 RGDID:1305670 Length:165 Species:Rattus norvegicus


Alignment Length:141 Identity:54/141 - (38%)
Similarity:81/141 - (57%) Gaps:11/141 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 KCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLND---KCFARNGQLFCKEDFFKRYGTK-- 180
            :|.||...|.|||:|..::..||::||:||.|..||.|   .|:.::|.:.|:.|:.:.:|..  
  Rat    22 RCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGA 86

  Fly   181 CSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYEEAKAKGLY 245
            ||||...||.:::|.|||.|||||:||.|:.|...|..||.|:.: :..|.|:.|...|     .
  Rat    87 CSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYI-NGSLFCEHDRPTA-----L 145

  Fly   246 LDGSLDGDQPN 256
            ::|.|:..|.|
  Rat   146 INGHLNSLQSN 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754 21/53 (40%)
LIM2_Lhx3_Lhx4 181..236 CDD:188762 25/54 (46%)
Homeobox 259..312 CDD:278475
Lmo4NP_001009708.1 LIM1_LMO4 23..77 CDD:188772 21/53 (40%)
LIM2_LMO4 87..141 CDD:188773 25/54 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.