DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim3 and ap

DIOPT Version :9

Sequence 1:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster


Alignment Length:360 Identity:104/360 - (28%)
Similarity:148/360 - (41%) Gaps:127/360 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ISRNRALEATIPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQL--NDKCFARNGQLFCKE 171
            |:||      :..|.||...|.|||.|..:|:.|||.||||..|...|  ...|::|:|.::||.
  Fly   141 ITRN------LDDCSGCGRQIQDRFYLSAVEKRWHASCLQCYACRQPLERESSCYSRDGNIYCKN 199

  Fly   172 DFFKRYGT-KCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRD 235
            |::..:|| :||.|...|...::|.||::.|:|:.||.|.:|...|..||::.:: |..:.|:..
  Fly   200 DYYSFFGTRRCSRCLASISSNELVMRARNLVFHVNCFCCTVCHTPLTKGDQYGII-DALIYCRTH 263

  Fly   236 Y----------------------------------------------------------EEAKAK 242
            |                                                          :.|:.|
  Fly   264 YSIAREGDTASSSMSATYPYSAQFGSPHNDSSSPHSDPSRSIVPTGIFVPASHVINGLPQPARQK 328

  Fly   243 GL---------------------YLD---GS-LDGDQPNKRPRTTITAKQLETLKT--AYNNSPK 280
            |.                     |:|   || |......||.||:....||.|:|:  |.|::| 
  Fly   329 GRPRKRKPKDIEAFTANIDLNTEYVDFGRGSHLSSSSRTKRMRTSFKHHQLRTMKSYFAINHNP- 392

  Fly   281 PARHVREQLSQDTGLDMRVVQVWFQNRRAKEKR--LKKDAGRTRWSQYFRSMKGNCSPRTDKFLD 343
            .|:.:: ||||.|||..||:||||||.|||.:|  :|:|.                    ...|:
  Fly   393 DAKDLK-QLSQKTGLPKRVLQVWFQNARAKWRRMMMKQDG--------------------SGLLE 436

  Fly   344 KDELKVDYDSFSHHDLSNDSY------STVNLGLD 372
            |.|..:|.||.|.|  |..|:      ||..|.||
  Fly   437 KGEGALDLDSISVH--SPTSFILGGPNSTPPLNLD 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754 23/52 (44%)
LIM2_Lhx3_Lhx4 181..236 CDD:188762 18/54 (33%)
Homeobox 259..312 CDD:278475 28/54 (52%)
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755 23/52 (44%)
LIM2_Lhx2_Lhx9 206..264 CDD:188763 20/58 (34%)
Homeobox 371..424 CDD:395001 28/54 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444988
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.