DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim3 and Lhx6

DIOPT Version :9

Sequence 1:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001101307.2 Gene:Lhx6 / 311901 RGDID:1306174 Length:392 Species:Rattus norvegicus


Alignment Length:208 Identity:83/208 - (39%)
Similarity:122/208 - (58%) Gaps:17/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 CGGCHELILDRFILKVLERTWHAKCLQCSECHGQL--NDKCFARNGQLFCKEDFFKRYGTKCSAC 184
            |..|...||||::|||....||.:||:||.|...|  .:.|:.:|.:::||.|:|.|:||||:.|
  Rat    99 CSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQNSCYIKNKEIYCKMDYFSRFGTKCARC 163

  Fly   185 DMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYE---------EAK 240
            ...|..:..||||:.|.|||.||.|..|.|.|:||:||.|:|: |::|:..|:         ...
  Rat   164 GRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEE-KVLCRIHYDTMIENLKRAAEN 227

  Fly   241 AKGLYLDGSLDGDQ-----PNKRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVV 300
            ..||.|:|::..:|     |.||.||:.||:||:.::..:.....|.....::|:..|||..||:
  Rat   228 GNGLTLEGAVPSEQDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVI 292

  Fly   301 QVWFQNRRAKEKR 313
            ||||||.||:.|:
  Rat   293 QVWFQNCRARHKK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754 21/52 (40%)
LIM2_Lhx3_Lhx4 181..236 CDD:188762 25/54 (46%)
Homeobox 259..312 CDD:278475 21/52 (40%)
Lhx6NP_001101307.2 LIM1_Lhx6 99..152 CDD:188766 21/52 (40%)
LIM2_Lhx6 160..214 CDD:188768 25/54 (46%)
Homeobox 252..305 CDD:395001 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.