DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim3 and FHL1

DIOPT Version :9

Sequence 1:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_006724806.1 Gene:FHL1 / 2273 HGNCID:3702 Length:339 Species:Homo sapiens


Alignment Length:165 Identity:43/165 - (26%)
Similarity:67/165 - (40%) Gaps:22/165 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 HPHHNHLAVDQDDPNPELVLALISRNRALEATIPKCGGCHELIL--DRFILKVLERTWHAKCLQC 149
            ||..|...|.:|:       .::..........|||.||.:.|:  |:.: :.....||..|..|
Human    89 HPLANETFVAKDN-------KILCNKCTTREDSPKCKGCFKAIVAGDQNV-EYKGTVWHKDCFTC 145

  Fly   150 SECHGQLNDKCFARNGQLF----CKEDFFKRYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCA 210
            |.|...:....|...|:.|    |.|..|.::   |..|:..|....:.  .||..:|..||:|.
Human   146 SNCKQVIGTGSFFPKGEDFYCVTCHETKFAKH---CVKCNKAITSGGIT--YQDQPWHADCFVCV 205

  Fly   211 MCSRTLNTGDEFYLMEDRK--LICKRDYEEAKAKG 243
            .||:.| .|..|..:||:.  :.|.:::...|..|
Human   206 TCSKKL-AGQRFTAVEDQYYCVDCYKNFVAKKCAG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754 16/56 (29%)
LIM2_Lhx3_Lhx4 181..236 CDD:188762 17/56 (30%)
Homeobox 259..312 CDD:278475
FHL1XP_006724806.1 LIM <21..49 CDD:413332
LIM1_FHL1 56..109 CDD:188730 5/26 (19%)
LIM2_FHL1 117..174 CDD:188808 16/57 (28%)
LIM3_FHL1 178..230 CDD:188813 17/54 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.