DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim3 and Lmo2

DIOPT Version :10

Sequence 1:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_032531.2 Gene:Lmo2 / 16909 MGIID:102811 Length:228 Species:Mus musculus


Alignment Length:184 Identity:54/184 - (29%)
Similarity:94/184 - (51%) Gaps:31/184 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PPTPQASHLVGGQQQQQQHPHHNHLAVDQD--DPNPELVLALISRNRALEATIPKCGGCHELILD 131
            ||:|.:|                  |:::.  ||:.|.|..::.    :..::..||||.:.|.|
Mouse    67 PPSPMSS------------------AIERKSLDPSEEPVDEVLQ----IPPSLLTCGGCQQNIGD 109

  Fly   132 RFILKVLERTWHAKCLQCSECH---GQLNDKCFARNGQLFCKEDFFKRYGTK--CSACDMGIPPT 191
            |:.||.:::.||..||.|..|.   |::..:.:.:.|:..|:.|:.:.:|..  |::||..|...
Mouse   110 RYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAY 174

  Fly   192 QVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRD-YEEAKAKGL 244
            ::..|.:|.||||:||.||.|.:....||. ||:.:..::|::| ||..|..|:
Mouse   175 EMTMRVKDKVYHLECFKCAACQKHFCVGDR-YLLINSDIVCEQDIYEWTKINGI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754 18/53 (34%)
LIM2_Lhx3_Lhx4 181..236 CDD:188762 21/55 (38%)
Homeodomain 257..313 CDD:459649
Lmo2NP_032531.2 LIM1_LMO2 100..155 CDD:188770 19/54 (35%)
LIM2_LMO2 164..219 CDD:188771 21/55 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.