DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10700 and TRR2

DIOPT Version :9

Sequence 1:NP_609942.1 Gene:CG10700 / 35183 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_011974.1 Gene:TRR2 / 856506 SGDID:S000001148 Length:342 Species:Saccharomyces cerevisiae


Alignment Length:385 Identity:72/385 - (18%)
Similarity:133/385 - (34%) Gaps:131/385 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TGDIENFPGL-DSLPCHRVNVDSRGQVLVQVKRSYLLRHARIKSMACRNWQDQRHFVVVGGGPSG 143
            |.|||||||. :||                                                 ||
Yeast    72 TTDIENFPGFPESL-------------------------------------------------SG 87

  Fly   144 AVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLALREEQFYKDYGIEMQLGVSAE 208
            :..:|.:|::.......::          |..::.::..:|...|..| |.:|          ||
Yeast    88 SELMERMRKQSAKFGTNII----------TETVSKVDLSSKPFRLWTE-FNED----------AE 131

  Fly   209 RLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGVHL---KNVKVIRNIGDARSIFKMVDKS 270
            .:.|               |.|.:|||.||...::||...   :.:........|..||:  :|.
Yeast   132 PVTT---------------DAIILATGASAKRMHLPGEETYWQQGISACAVCDGAVPIFR--NKP 179

  Fly   271 TQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQRILKLLEENKVDLRMSSGI 335
            ..|:..|.|  |.|....|...|..|.::.|:: .|::::  ::.:||     |...::.:....
Yeast   180 LAVIGGGDS--ACEEAEFLTKYASKVYILVRKD-HFRASV--IMQRRI-----EKNPNIIVLFNT 234

  Fly   336 IRILGNSRGEVVAVKLLDNSR------IPCNLLILGTGCQCNTDFL------QRSG-ININPNGS 387
            :.:.....|:::.:..:.|::      :..|.|....|....||.:      :.:| |...|..|
Yeast   235 VALEAKGDGKLLNMLRIKNTKSNVENDLEVNGLFYAIGHSPATDIVKGQVDEEETGYIKTVPGSS 299

  Fly   388 VDVNDFLQTKVRNVYVGGDIANAYILGGFPDRVNISHYGLAQYHGRIAALNMSGHIAKLE 447
            :       |.|...:..||:.::..      |..::..|    .|.||||:...:::..|
Yeast   300 L-------TSVPGFFAAGDVQDSRY------RQAVTSAG----SGCIAALDAERYLSAQE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 10/26 (38%)
Pyr_redox_2 135..414 CDD:285266 54/294 (18%)
Pyr_redox 273..350 CDD:278498 14/76 (18%)
COG3393 336..>508 CDD:225928 23/125 (18%)
Reductase_C 464..527 CDD:291425
TRR2NP_011974.1 TRX_reduct 28..338 CDD:273540 71/379 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345490
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.