DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10700 and PYROXD1

DIOPT Version :9

Sequence 1:NP_609942.1 Gene:CG10700 / 35183 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_079130.2 Gene:PYROXD1 / 79912 HGNCID:26162 Length:500 Species:Homo sapiens


Alignment Length:459 Identity:77/459 - (16%)
Similarity:153/459 - (33%) Gaps:151/459 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 FVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYD------RTRIMNLLNTYTKNLALREEQ 192
            |||||||.:|..|.|.|              ..|.|.:      .:.::..:..:.:...:.|| 
Human    13 FVVVGGGIAGVTCAEQL--------------ATHFPSEDILLVTASPVIKAVTNFKQISKILEE- 62

  Fly   193 FYKDYGIEMQLGVSAERLDTNCNTL-----------HC---TNGKTFPYDKIYIATGYSAV---- 239
                :.:|.|......:...|...:           ||   .:|....|.|:.:..|....    
Human    63 ----FDVEEQSSTMLGKRFPNIKVIESGVKQLKSEEHCIVTEDGNQHVYKKLCLCAGAKPKLICE 123

  Fly   240 -TPNIPGVHLKNVKVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVE------------------- 284
             .|.:.|        ||:...|:...|.:.|:.:::.:|:..:|:|                   
Human   124 GNPYVLG--------IRDTDSAQEFQKQLTKAKRIMIIGNGGIALELVYEIEGCEVIWAIKDKAI 180

  Fly   285 ------------ATANLVS----------RARSVTLVARQNVPFKS---TLGELIGQ-------- 316
                        .|:.|::          |.|..|...::....||   .:|..:|.        
Human   181 GNTFFDAGAAEFLTSKLIAEKSEAKIAHKRTRYTTEGRKKEARSKSKADNVGSALGPDWHEGLNL 245

  Fly   317 ----------RILKLLEENKVDLRMSSGIIR------------ILGNSRGEVVAVKLLDNSRIPC 359
                      .:..:.|..|:.|:....|::            :..::....|.|:|.:.....|
Human   246 KGTKEFSHKIHLETMCEVKKIYLQDEFRILKKKSFTFPRDHKSVTADTEMWPVYVELTNEKIYGC 310

  Fly   360 NLLILGTGCQCNTD-FLQRSGININPNGSVDVNDFLQTKVRNVYVGGDI-ANAYILGGFPDRVNI 422
            :.::..||...|.: ||..:..::..:|.:.|:|.:.|.:.::|..||| ..::.|.....::.:
Human   311 DFIVSATGVTPNVEPFLHGNSFDLGEDGGLKVDDHMHTSLPDIYAAGDICTTSWQLSPVWQQMRL 375

  Fly   423 SHYGLAQYHGRIAALNMS-----------------GHIAKLEAIPFFYTVIFGRAFRSAGYGPFK 470
              :..|:..|..||..|:                 .|:.|.    |.|.|:....:.:.|.|...
Human   376 --WTQARQMGWYAAKCMAAASSGDSIDMDFSFELFAHVTKF----FNYKVVLLGKYNAQGLGSDH 434

  Fly   471 DVVI 474
            ::::
Human   435 ELML 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 63/379 (17%)
Pyr_redox 273..350 CDD:278498 17/150 (11%)
COG3393 336..>508 CDD:225928 30/170 (18%)
Reductase_C 464..527 CDD:291425 2/11 (18%)
PYROXD1NP_079130.2 Pyr_redox_2 24..383 CDD:330998 58/387 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..235 5/23 (22%)
NirB <300..>494 CDD:330997 29/145 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.