DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10700 and Sqor

DIOPT Version :9

Sequence 1:NP_609942.1 Gene:CG10700 / 35183 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001155975.1 Gene:Sqor / 59010 MGIID:1929899 Length:450 Species:Mus musculus


Alignment Length:320 Identity:73/320 - (22%)
Similarity:127/320 - (39%) Gaps:50/320 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ACRNWQDQRHFVVVGGGPSGAVCVETLRQEGFTGRLTLV-CGEKHLPYDRTRIMNLLNTYTKNLA 187
            ||...::....:|:|||..|......:::......:.:| ..|:|. |.  .|..|:....|.|:
Mouse    36 ACCTAKNHYEVLVLGGGAGGITMATRMKRRVGAENVAIVEPSERHF-YQ--PIWTLVGAGAKELS 97

  Fly   188 L--REEQFYKDYGIE-MQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGV--- 246
            |  |........|:: :|..|:....|.||  :...:||...|..:.||.|.......|.|:   
Mouse    98 LSVRSTLSVIPSGVQWIQDRVAELNPDENC--IRTDSGKEISYRYLIIALGIQLDYEKIKGLPEG 160

  Fly   247 ----------HLKNV----KVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSRA--RS 295
                      .:|.|    |.::...:..::|..  .:|.|.|.|:....:     .:|.|  |.
Mouse   161 FAYPKIGSNYSVKTVEKTWKALQGFKEGNALFTF--PNTPVKCAGAPQKIM-----YLSEAYFRK 218

  Fly   296 VTLVARQNVPFKSTLGELIGQR-----ILKLLEENKVDLRMSSGIIRILGNSRGEVVAVKLLDNS 355
            .....:.|:.|.:.||.:.|.:     :.:::.|..|.:.....:|.:..:.:..|  .::||..
Mouse   219 TGKRPKANIIFNTALGTIFGVKKYADALQEIIRERDVSVNYKHNLIEVRPDKQEAV--FEILDKP 281

  Fly   356 R----IPCNLLILGTGCQCNTDFLQRSGININPNGSVDVN-DFLQ-TKVRNVYVGGDIAN 409
            .    ||..:|.: |......|.|:||.: .:..|.|||: :.|| .|..||:..||..|
Mouse   282 GETHVIPYEMLHV-TPPMSAPDVLKRSPV-ADSAGWVDVDKETLQHKKYPNVFGIGDCTN 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 71/309 (23%)
Pyr_redox 273..350 CDD:278498 15/83 (18%)
COG3393 336..>508 CDD:225928 24/80 (30%)
Reductase_C 464..527 CDD:291425
SqorNP_001155975.1 FadH2 46..397 CDD:223523 71/310 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.