DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10700 and SQOR

DIOPT Version :9

Sequence 1:NP_609942.1 Gene:CG10700 / 35183 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001258142.1 Gene:SQOR / 58472 HGNCID:20390 Length:450 Species:Homo sapiens


Alignment Length:324 Identity:71/324 - (21%)
Similarity:126/324 - (38%) Gaps:57/324 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SMACRNWQDQRHF--VVVGGGPSGAVCVETLRQEGFTGRLTLV-CGEKHLPYDRTRIMNLLNTYT 183
            |.|.||     |:  :|:|||..|......::::.....:.:| ..|:|. |.  .|..|:....
Human    37 SHAARN-----HYEVLVLGGGSGGITMAARMKRKVGAENVAIVEPSERHF-YQ--PIWTLVGAGA 93

  Fly   184 KNLAL--REEQFYKDYGIE-MQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPG 245
            |.|:.  |........|:| ::..|:....|.||  :|..:.:...|..:.||.|.......|.|
Human    94 KQLSSSGRPTASVIPSGVEWIKARVTELNPDKNC--IHTDDDEKISYRYLIIALGIQLDYEKIKG 156

  Fly   246 V-----HLK-----NVKVIRNIGDARSIFK-----MVDKSTQVVCLGSSFMAVEATANLVSRA-- 293
            :     |.|     :||.:.....|...||     ....:|.|.|.|:....:     .:|.|  
Human   157 LPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIM-----YLSEAYF 216

  Fly   294 RSVTLVARQNVPFKSTLGELIGQR-----ILKLLEENKVDLRMSSGIIRILGNSRGEVVAVKLLD 353
            |.....::.|:.|.::||.:.|.:     :.::::|..:.:.....:|.:..:.:..|     .:
Human   217 RKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAV-----FE 276

  Fly   354 NSRIPCNLLILG------TGCQCNTDFLQRSGININPNGSVDVN-DFLQ-TKVRNVYVGGDIAN 409
            |...|....::.      |......|.|:.|.: .:..|.|||: :.|| .:..||:..||..|
Human   277 NLDKPGETQVISYEMLHVTPPMSPPDVLKTSPV-ADAAGWVDVDKETLQHRRYPNVFGIGDCTN 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 66/309 (21%)
Pyr_redox 273..350 CDD:278498 14/83 (17%)
COG3393 336..>508 CDD:225928 19/82 (23%)
Reductase_C 464..527 CDD:291425
SQORNP_001258142.1 FadH2 56..398 CDD:223523 61/300 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.