DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10700 and CG7430

DIOPT Version :9

Sequence 1:NP_609942.1 Gene:CG10700 / 35183 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001262000.1 Gene:CG7430 / 39988 FlyBaseID:FBgn0036762 Length:504 Species:Drosophila melanogaster


Alignment Length:410 Identity:82/410 - (20%)
Similarity:144/410 - (35%) Gaps:112/410 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 CRNWQDQRHFVVVGGGPSGAV-----------------------------CVET----------- 149
            |.:...:...||:|.||.|.|                             |:.:           
  Fly    31 CYSSTHEADIVVIGSGPGGYVAAIKAAQMGMKTVSVEKEATLGGTCLNVGCIPSKALLNNSHYYH 95

  Fly   150 LRQEGFTGRLTLVCGEKHLPYDRTRIM----NLLNTYTKNLALREEQFYKDYGIEMQLG------ 204
            :...|...:..:.||...|  |..::|    |.:...|..:|:    .:|...:....|      
  Fly    96 MAHSGDLEKRGISCGSVSL--DLEKLMGQKSNAVKALTGGIAM----LFKKNKVTQLTGFGTIVN 154

  Fly   205 ---VSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGVHLKNVKVIRNIGDARSIFKM 266
               |..::.|.:..|:...|        |.|||| |.||| .||:.:....::.:.|    ..|:
  Fly   155 PNEVEVKKSDGSTETVKTKN--------ILIATG-SEVTP-FPGIEIDEEVIVSSTG----ALKL 205

  Fly   267 VDKSTQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGEL-IGQRILKLLEE--NKVD 328
            ......:|.:|:..:.:|..:........||.     :.|..|:|.: |...:.|..::  .|..
  Fly   206 AKVPKHLVVIGAGVIGLELGSVWSRLGAEVTA-----IEFMDTIGGVGIDNEVSKTFQKVLTKQG 265

  Fly   329 LRMSSGIIRILGNSRGEVVAVKLLDNSR------IPCNLLILGTGCQCNTD--FLQRSGININPN 385
            |:...|......:..|:.|.|. ::|::      |.|:.|::..|.:..|:  .|:..||..:..
  Fly   266 LKFKLGTKVTAASRSGDNVTVS-VENAKSGEKEEIQCDALLVSVGRRPYTEGLGLEAVGIVKDDR 329

  Fly   386 GSVDVNDFLQTKVRNVYVGGDIANAYIL----------------GGFPDRVNISHY---GLAQYH 431
            |.:.||...||.|.|:|..||..:..:|                ||   .|:|.:.   .:...|
  Fly   330 GRIPVNATFQTVVPNIYAIGDCIHGPMLAHKAEDEGLITIEGINGG---HVHIDYNCVPSVVYTH 391

  Fly   432 GRIAALNMSGHIAKLEAIPF 451
            ..:|.:..|....|.|.:.:
  Fly   392 PEVAWVGKSEEQLKQEGVAY 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 72/358 (20%)
Pyr_redox 273..350 CDD:278498 15/79 (19%)
COG3393 336..>508 CDD:225928 32/143 (22%)
Reductase_C 464..527 CDD:291425
CG7430NP_001262000.1 PRK06327 35..504 CDD:235779 81/406 (20%)
NADB_Rossmann 35..>74 CDD:304358 7/38 (18%)
Pyr_redox 211..290 CDD:278498 16/84 (19%)
Pyr_redox_dim 385..491 CDD:280934 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464307
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.