DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10700 and CG14997

DIOPT Version :9

Sequence 1:NP_609942.1 Gene:CG10700 / 35183 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_647877.1 Gene:CG14997 / 38514 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster


Alignment Length:334 Identity:70/334 - (20%)
Similarity:124/334 - (37%) Gaps:95/334 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 VVVGGGPSG---------------AVCVETLRQEGFTGRLTLV-CGEKHLPYDRTRIMNLLNTYT 183
            :|||||..|               .|.:|...:..:....||: .|.|.|.....::.::|.|..
  Fly    47 LVVGGGTGGCAMAAKLSSRLGSDKVVVLEPEDKHYYQPMFTLIGGGMKRLDQSHRQMADVLPTKA 111

  Fly   184 KNLALREEQFYKDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGV-- 246
            |        :.|:..:|         .|.:.||:..:.|||..||.:.||||.......|||:  
  Fly   112 K--------WVKEKALE---------FDPDNNTVSTSGGKTIKYDFLIIATGLQLNYGKIPGLVE 159

  Fly   247 ----------------HLKNV-KVIRNIGDARSIFKMVDKSTQVVCLGS----SFMAVEATANLV 290
                            ::.:| :.:|......:||..  .:..:.|.|:    :::: |.....:
  Fly   160 ALETPDSNVCSIYSPKYVDHVYECLRRTNKGNAIFTF--PNCPIKCAGAPQKIAYIS-EHYFRKM 221

  Fly   291 SRARSVTLVARQNVPFKSTLGELIG-----QRILKLLEENKVDLRMSSGIIRILGNSRGEVVAVK 350
            .|..:|      |:.:.::|..:.|     :.::||::...:.|           |.:..:|.|:
  Fly   222 GRRDNV------NIIYNTSLPVIFGVKHYAEALMKLIKRRNITL-----------NVQRNLVEVR 269

  Fly   351 LLDNSRIPCNLLILG------------TGCQCNTDFLQRSGININPNGSVDVNDF-LQ-TKVRNV 401
            ..||..:..:|...|            |......|.:......:.|.|.|||:.. || .|..||
  Fly   270 HKDNIAVFEDLAKPGVHYEETYSMLHVTPPMSTPDVVANCKKLVTPTGFVDVDQLTLQHNKYSNV 334

  Fly   402 YVGGDIANA 410
            :..||.|::
  Fly   335 FAIGDSASS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 70/334 (21%)
Pyr_redox 273..350 CDD:278498 13/85 (15%)
COG3393 336..>508 CDD:225928 22/89 (25%)
Reductase_C 464..527 CDD:291425
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 63/319 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.