DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10700 and Trxr-1

DIOPT Version :9

Sequence 1:NP_609942.1 Gene:CG10700 / 35183 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_727251.1 Gene:Trxr-1 / 31760 FlyBaseID:FBgn0020653 Length:596 Species:Drosophila melanogaster


Alignment Length:393 Identity:73/393 - (18%)
Similarity:136/393 - (34%) Gaps:110/393 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 IKSMACRNWQDQRHFVVVGGGPSGAVCVE-------------------TLRQE-GFTGRLTLV-C 163
            ::.|:.:........:|:|||.:|..|.:                   ||..: |..|....| |
  Fly   103 VRKMSTKGGSYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGC 167

  Fly   164 GEKHLPYDRTRIMNLLN---TYTKNLALREEQFYKDYGIEMQLGVSAE----------RLDTNCN 215
            ..|.|.:..:.:...::   .|..|:   :|:...|:   .:|..|.:          |:|....
  Fly   168 IPKKLMHQASLLGEAVHEAAAYGWNV---DEKIKPDW---HKLVQSVQNHIKSVNWVTRVDLRDK 226

  Fly   216 TLHCTNG------------------KTFPYDKIYIATGYSAVTPNIPGVHLKNVKVIRNIGDARS 262
            .:...||                  :|.......||.|.....|:|||.....:       .:..
  Fly   227 KVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGI-------TSDD 284

  Fly   263 IFKMVDKSTQVVCLGSSFMAVEATANLVSRARSVTLVARQNV--PFKSTLGELIGQRILKLLEEN 325
            :|.:..:..:.:.:|:.::.:|....|.......|::.|..|  .|...:.||:...    :||.
  Fly   285 LFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAAS----MEER 345

  Fly   326 KVD-LRMSSGIIRILGNSRGEVVAVKLLDNSRIPCNLLILGTGCQCNTDF------LQRSGI--N 381
            .:. ||.:..:            :|:..|:.::......:.||.:....:      :.|.|:  :
  Fly   346 GIPFLRKTVPL------------SVEKQDDGKLLVKYKNVETGEEAEDVYDTVLWAIGRKGLVDD 398

  Fly   382 IN-PNGSVDV-NDFL------QTKVRNVYVGGDIANAYILGGFPDRVNISHYGLAQYHGRIAALN 438
            :| ||..|.| .|.:      .|.|.|:|..||     |:.|.|:...:     |...||:.|..
  Fly   399 LNLPNAGVTVQKDKIPVDSQEATNVANIYAVGD-----IIYGKPELTPV-----AVLAGRLLARR 453

  Fly   439 MSG 441
            :.|
  Fly   454 LYG 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 65/349 (19%)
Pyr_redox 273..350 CDD:278498 13/79 (16%)
COG3393 336..>508 CDD:225928 26/122 (21%)
Reductase_C 464..527 CDD:291425
Trxr-1NP_727251.1 TGR 113..595 CDD:273624 72/383 (19%)
NADB_Rossmann 115..>150 CDD:304358 6/34 (18%)
Pyr_redox 294..368 CDD:278498 15/89 (17%)
Pyr_redox_dim 468..577 CDD:280934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464298
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.