DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and Prss8

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:266 Identity:81/266 - (30%)
Similarity:130/266 - (48%) Gaps:30/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGKSLVQGHFYKG----LGSYPFVARIGF--KHVNTGAFAYPCAGAVIARRVILTAAHCALAKAD 182
            || :::|.....|    .|.:|:...|.:  .||        |.|::::.:.:::|||| ..:..
Mouse    37 CG-AVIQPRITGGGSAKPGQWPWQVSITYDGNHV--------CGGSLVSNKWVVSAAHC-FPREH 91

  Fly   183 GHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYS 247
            ......|::|.:...|         .:..:|.|.::.:|.|..|::.....||||:.|.:|:.:|
Mouse    92 SREAYEVKLGAHQLDS---------YSNDTVVHTVAQIITHSSYREEGSQGDIALIRLSSPVTFS 147

  Fly   248 VATQPICLQKTRANLVVGKRATIAGWGKMSTS-SVRQPE-MSHLDVPLTSWDLCLRNYGSTGALE 310
            ...:||||....|:...|...|:.|||.::.| |::.|. :..|:|||.|.:.|...|......|
Mouse   148 RYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPE 212

  Fly   311 SPNSIEGQWMCAG--GEGKDVCQGFGGAPLFIQENGIFSQIGIMSFGSDNCGGLRIPSVYTSVAH 373
            .|::|:...:|||  ..|||.|||..|.||.....||:...||:|:| |.||....|.|||..:.
Mouse   213 EPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWG-DACGAPNRPGVYTLTST 276

  Fly   374 FSEWIH 379
            ::.|||
Mouse   277 YASWIH 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 77/248 (31%)
Tryp_SPc 138..378 CDD:214473 74/245 (30%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12550
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.