DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG34171

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:270 Identity:74/270 - (27%)
Similarity:117/270 - (43%) Gaps:47/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 YKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSS 198
            |..|.|| .|:....|:::|....:.|.|.::..|.:||:|||...| :|..:|..|:      .
  Fly    32 YSHLSSY-LVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDK-NGVMMSPKRI------V 88

  Fly   199 DPDCANTGFCAPRSVNHA--ISHVIVHPDYKQGQYHHDIALLVLKTPL---NYSVATQPICLQKT 258
            ...||:. |..|.|....  |.::|:||.|.:.| |:|||::.||..:   .:.:|  |:.|  .
  Fly    89 VALCASL-FKTPESEEFVVDIHNMIIHPYYHRNQ-HNDIAIIKLKRYVKLDGHHLA--PVVL--G 147

  Fly   259 RANLVVGKRA-TIAGWGKMSTSSVRQP------EMSHLDVPLTSWDLCLRNYGSTGALESPNSIE 316
            .::|.||... ||.|     ...||:.      .|..::|.|..:|.||:...|..|....|.  
  Fly   148 NSSLEVGNDCKTIGG-----IFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENE-- 205

  Fly   317 GQWMCAGGEGKDVCQGFGGAPLFIQENGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWIH-- 379
             ..:|.....|.:|....|.|||..     .|:..::.||.||.. ..|..::.|:.::.|:.  
  Fly   206 -DLICVKSTEKQMCTTDFGGPLFCD-----GQLYGIALGSINCSS-PDPVFFSDVSFYNSWVTKI 263

  Fly   380 -----DNTPP 384
                 |:|.|
  Fly   264 ISEAVDHTRP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 69/261 (26%)
Tryp_SPc 138..378 CDD:214473 68/251 (27%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 70/255 (27%)
Tryp_SPc 38..263 CDD:304450 68/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.