DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:266 Identity:66/266 - (24%)
Similarity:102/266 - (38%) Gaps:48/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VQGHFYKGLGSY----PFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSV 189
            :||....|..:|    |::..:.|    :|...:.|.|::|....:||||||.      :..|.|
  Fly    34 IQGRITNGYPAYEGKVPYIVGLLF----SGNGNWWCGGSIIGNTWVLTAAHCT------NGASGV 88

  Fly   190 RVGEYDTS--SDPDCANTGFCAPRSVNHAI--SHVIVHPDYKQGQYHHDIALLVLKTP---LNYS 247
            .: .|..|  :.|           ...|.:  .:.:.|..|..|..|:||:|  ::||   ..:.
  Fly    89 TI-NYGASLRNQP-----------QYTHWVGSGNFVQHHHYNSGNLHNDISL--IRTPHVDFWHL 139

  Fly   248 VATQPICLQKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESP 312
            |....:.....|.....|..|..:|||.....|.....:..:||.:.|...|.|.:         
  Fly   140 VNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRTW--------- 195

  Fly   313 NSIEGQWMCAG-GEGKDVCQGFGGAPLFIQENGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSE 376
             |:....:|.. ..||..|.|..|.||...|..  ..:|:.||.|........|:|::.|..:.:
  Fly   196 -SLHDNMICINTNGGKSTCGGDSGGPLVTHEGN--RLVGVTSFVSSAGCQSGAPAVFSRVTGYLD 257

  Fly   377 WIHDNT 382
            ||.|||
  Fly   258 WIRDNT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 60/254 (24%)
Tryp_SPc 138..378 CDD:214473 58/251 (23%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 59/257 (23%)
Tryp_SPc 38..262 CDD:238113 61/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.