DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:266 Identity:74/266 - (27%)
Similarity:114/266 - (42%) Gaps:46/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VQGHFYKG----LGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSV 189
            ::|....|    .|..|::..:.   :|:....:.|.|::|....:||||||. |.||.   :|:
  Fly    37 IEGRITNGNLASEGQVPYIVGVS---LNSNGNWWWCGGSIIGHTWVLTAAHCT-AGADE---ASL 94

  Fly   190 RVGEYDTSSDPDCANTGFCAPRSVNHAIS--HVIVHPDYKQGQYHHDIALLVLKTP-LNYSVATQ 251
            ..|..: .::|           :..|.:|  :.|.:|.|.  ...||:||  :||| :::.....
  Fly    95 YYGAVN-YNEP-----------AFRHTVSSENFIRYPHYV--GLDHDLAL--IKTPHVDFYSLVN 143

  Fly   252 PICLQK--TRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESPNS 314
            .|.|..  .|.|.........||||.:...|....::..:|:.:.|...|...||:..|.|:...
  Fly   144 KIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTIC 208

  Fly   315 IEGQWMCAGGEGKDVCQGFGGAPLFIQENGIFSQIGIMSFGSD-NC--GGLRIPSVYTSVAHFSE 376
            :|..      :||..|||..|.||..:|..  ..|||.||.|. .|  ||   |:.:|.|..:.|
  Fly   209 VETP------DGKATCQGDSGGPLVTKEGD--KLIGITSFVSAYGCQVGG---PAGFTRVTKYLE 262

  Fly   377 WIHDNT 382
            ||.:.|
  Fly   263 WIKEET 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 71/250 (28%)
Tryp_SPc 138..378 CDD:214473 69/247 (28%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 70/257 (27%)
Tryp_SPc 41..266 CDD:238113 72/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.