DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG11843

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:320 Identity:93/320 - (29%)
Similarity:144/320 - (45%) Gaps:63/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 EVARSCYYGDKSLY---------CGGSSEELPYV--CCPSSPLEKNQVCGKSLVQGHFYKGLGSY 140
            :|..||....||::         ..|:|.|...:  |...:||         :|.||..:. ..:
  Fly    25 DVVGSCSRYKKSVFEERIEFGFLLPGASIESRIIDNCRSYTPL---------IVGGHPAQP-REF 79

  Fly   141 PFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSS-DPDCAN 204
            |.:||:|.:...:....:.|.|.:|:.|.:||||||  .:::...::.||:||.|..| |.|   
  Fly    80 PHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHC--LESERGEVNVVRLGELDFDSLDED--- 139

  Fly   205 TGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPICL--QKTRANLVVGKR 267
               .|||  ::.::..|.||.|:..|::|||.|:.|...:.:.:...|.||  |..|::     .
  Fly   140 ---AAPR--DYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSS-----D 194

  Fly   268 ATIA-GWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGS-------TGALES-PNSIEG-QWMCA 322
            :.|| |||  ||....:|....|.|.       |:.||:       |..:|. |...:| ..:|.
  Fly   195 SFIAVGWG--STGLALKPSAQLLKVK-------LQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCV 250

  Fly   323 GGE-GKDVCQGFGGAPLFIQENG---IFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378
            |.| .:|.|.|..|.||.:....   ::..:||.|.|. :||...||.:||.|..:..||
  Fly   251 GSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGL-SCGSPGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 79/258 (31%)
Tryp_SPc 138..378 CDD:214473 77/256 (30%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 82/268 (31%)
Tryp_SPc 68..309 CDD:214473 80/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.