DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG4815

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:240 Identity:55/240 - (22%)
Similarity:88/240 - (36%) Gaps:65/240 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 CAGAVIARRVILTAAHC--ALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIV 222
            |:..::..|.|||||||  .|.::..|.:.. :..|:....:....|           .:..|.:
  Fly    61 CSATLLTPRHILTAAHCFENLNRSKFHVIGG-KSAEFTWHGNNFNKN-----------KLIRVQI 113

  Fly   223 HPDYKQGQYHHDIALLVLKTPLNYS-VATQPICLQKTRANLVVGKRATIAGWG------------ 274
            ||.|.:.::..|:|:...|.||... :....:|    |:.|....:...||||            
  Fly   114 HPKYAKMKFIADVAVAKTKYPLRSKYIGYAQLC----RSVLHPRDKLIAAGWGFEGGVWDESRKK 174

  Fly   275 -----KMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGG-EGKDVCQGF 333
                 |:...|.|..| ..||..:                 .||.|     |||. ..|.:|.|.
  Fly   175 TFRSMKVGIVSKRDCE-KQLDRKM-----------------PPNII-----CAGAYNNKTLCFGD 216

  Fly   334 GGAPLFIQENGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378
            .|.||.:..     |:..::..:..||....|.||..|.:::::|
  Fly   217 SGGPLLLGR-----QVCGINTWTFKCGNNEKPDVYMGVRYYAKFI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 55/240 (23%)
Tryp_SPc 138..378 CDD:214473 54/238 (23%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 55/240 (23%)
Trypsin 49..256 CDD:278516 54/238 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.