DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and SPE

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:318 Identity:96/318 - (30%)
Similarity:138/318 - (43%) Gaps:53/318 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VCCPSS----------------------PLEKNQVCGKSLVQGHFYKG----LGSYPFVARIGFK 149
            ||||.|                      .|..|.||| .|.....:.|    |..:|::..:.:|
  Fly    92 VCCPQSMRGNIMDSEPTPSTRDALQQGDVLPGNDVCG-FLFADRIFGGTNTTLWEFPWMVLLQYK 155

  Fly   150 HVNTGAFAYPCAGAVIARRVILTAAHCALAK---ADGHRLSSVRVGEYDTSSDPDCA----NTGF 207
            .:.:..:.:.|.||::..|.:|||.||..::   ..|..|.|||:||:||.:||||.    ....
  Fly   156 KLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRI 220

  Fly   208 CAPRSVNHAISHVIVHPDYKQG--QYHHDIALLVLKTPLNYSVATQPICLQKTR--ANLVVGKRA 268
            |||:.::..:...|:|..|...  ...:||||:.||..::|:...:||||....  .|..|....
  Fly   221 CAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGM 285

  Fly   269 TIAGWGKMSTSSVRQPEMSHLDVPLTSWDL--CLRNYGSTGALESPNSIEGQWMCAGGE-GKDVC 330
            .:||||   .:...||....|.:.:..|:|  |...|.|...     .::...|||||: |.|.|
  Fly   286 DVAGWG---LTENMQPSAIKLKITVNVWNLTSCQEKYSSFKV-----KLDDSQMCAGGQLGVDTC 342

  Fly   331 QGFGGAPLF--IQENG--IFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWIHDNTPP 384
            .|..|.||.  |...|  :|...|:.|:|:..||....|.|||....|.:||.....|
  Fly   343 GGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIKQKLEP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 82/260 (32%)
Tryp_SPc 138..378 CDD:214473 80/257 (31%)
SPENP_651168.1 CLIP 42..94 CDD:314844 1/1 (100%)
Tryp_SPc 135..397 CDD:238113 84/269 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.