DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG16710

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:361 Identity:108/361 - (29%)
Similarity:157/361 - (43%) Gaps:79/361 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CSVGTECTPLHDCTALI-------YEVARSCYYGDKSLYC--GGSSEEL---PYVCCPSSP--LE 119
            |::..:|..|..||:|:       ...|....:.|:  ||  |...:||   ..:|||:..  |.
  Fly    30 CNLDEKCISLARCTSLLPFLKPHNMTPAEKAVFEDR--YCGYGPKGQELLDRVLICCPNMGHILP 92

  Fly   120 KNQVCGKSLVQGHFYKG----LGSYPFVARIGFKHVNTGAF----AYPCAGAVIARRVILTAAHC 176
            ..|:||..:.....:.|    ....|::|.|.:.|.:...:    ...|||::|..|.:||||||
  Fly    93 NTQICGPIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHC 157

  Fly   177 ALAKADGHRLSSVRVGEYDTSSDPDCA----NTGFCAPRSVNHAISHVIVHPDYK--QGQYHHDI 235
              .:..|..|..||:||::..|:|||.    ....|||..:...:...|.|..|.  :.:.::||
  Fly   158 --LRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDI 220

  Fly   236 ALLVLKTPLNYSVATQPICLQ-------KTRANLVVGKRATIAGWGKMSTSSVRQPEMSH----L 289
            |||.||.|:.|:...:|||:|       .:.:|    .:..|||||           :||    .
  Fly   221 ALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSN----HKLQIAGWG-----------LSHKQGYS 270

  Fly   290 DVPLTSW------DLCLRNYGSTGALESPNSIEGQWMCAGG-EGKDVCQGFGGAPLF-IQENG-- 344
            :|.|.::      |.|..:..|.| |:....|     |||. .|.|.|:|..|.||. |.|.|  
  Fly   271 NVLLQAYVNGRNADECSLSEPSLG-LDKETHI-----CAGNLGGNDTCKGDSGGPLMAIMERGDE 329

  Fly   345 -IFSQIGIMSFGSDNCG-GLRIPSVYTSVAHFSEWI 378
             .....||.|:|...|| |   |:.||..:.|.|||
  Fly   330 EFVYLAGITSYGYSQCGYG---PAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 87/274 (32%)
Tryp_SPc 138..378 CDD:214473 85/272 (31%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 12/50 (24%)
Tryp_SPc 105..362 CDD:214473 86/282 (30%)
Tryp_SPc 106..362 CDD:238113 86/281 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.