DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG31199

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:272 Identity:67/272 - (24%)
Similarity:113/272 - (41%) Gaps:64/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 YPFVARI----GF--KHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSS 198
            :.:||||    ||  |..:.|     |.|.::::|.:|..|||.:.........||.:|.::.|:
  Fly    50 HQWVARIVYGKGFEGKIRDNG-----CLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSA 109

  Fly   199 DPD---CANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPIC------ 254
            ...   |...|:|...|....::.:.:||||......:.:|:|.|:..........|||      
  Fly   110 PVGVRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSL 174

  Fly   255 LQKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTG--------ALES 311
            |.:|    :|.:...:||        :|..|    |..|.:|    .|..|.|        .:.|
  Fly   175 LNET----LVAQTFVVAG--------LRVFE----DFRLKTW----VNTLSRGFCQSKVKTLVTS 219

  Fly   312 PNSIEGQWMCAGGEGKDVCQGFGGAPLF-IQENGIFSQ----IGIM-SFGSDNCGGLRIPSVYTS 370
            .|::     |  |..|.....:.||||. :|:.|..:|    :||| .:..:|   .||.|.:.:
  Fly   220 SNTV-----C--GYHKQPVAYYLGAPLVGLQKKGHVTQNYYLVGIMIDWRWEN---NRIMSSFLA 274

  Fly   371 VAHFSEWIHDNT 382
            :.::.::|..|:
  Fly   275 IRNYMDFIRQNS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 66/269 (25%)
Tryp_SPc 138..378 CDD:214473 65/266 (24%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 58/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.