DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and modSP

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:431 Identity:98/431 - (22%)
Similarity:152/431 - (35%) Gaps:108/431 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PILQLFAIVRAESGEFEKLLV-PVSHGS------------AEQRSGARSNETTGHSVAARSYYDV 60
            |||         :|:..::|. |::.|:            .|:.|....|:.:..::.....|  
  Fly   233 PIL---------TGDGSRVLTGPITRGTVRFSCKQGYVLEGEESSYCAKNKWSTSTIPKCVKY-- 286

  Fly    61 VQNAGQ-TGCSVGTECT----------PLHDCTALIYEVARSCYYGDKSLYCGGSSEELPYVCCP 114
            ...||: .|.|....||          |.|....   ||...|..|.|:|      ..||.:.|.
  Fly   287 CSTAGEFDGYSTKALCTHNGQQVECRKPFHPPGT---EVKFVCSTGFKTL------SPLPEMRCM 342

  Fly   115 SSPL------EKNQVCGKSLVQGHFYKGLGSYPFVARIGFKHV------NTGAFAYPCAGAVIAR 167
            ....      ...|.||:.......:.. |.|.....:...||      |...:.:.|.|:::..
  Fly   343 KGGYWNRGRQRCEQDCGQLATPIKQFSS-GGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTP 406

  Fly   168 RVILTAAHCALAKADGHRLSSVRVGEYDT---SSDPDCANTGFCAPRSVNHAISHVIVHPDYK-- 227
            .:::|||||..  .:|.||..    .|||   .:.....|.|...|......:..:.:.|.||  
  Fly   407 DLVITAAHCVY--DEGTRLPY----SYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGR 465

  Fly   228 QGQYHHDIALLVLKTPLNYSVATQPICL-------QKTRANLVVGKRATIAGWGKMSTSSVRQPE 285
            ...|:.|:|||.|..|...|...:|||:       :::..:.|.||   .|||     :...:.|
  Fly   466 TENYYQDLALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGK---FAGW-----NIENKHE 522

  Fly   286 MSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGGEGKDV-CQGFGGAPLFIQE--NGIFS 347
            :..:.....|..:|.||.         ..|:....|...:||.: |||..|.. |..|  ...||
  Fly   523 LQFVPAVSKSNSVCRRNL---------RDIQADKFCIFTQGKSLACQGDSGGG-FTSELPTNAFS 577

  Fly   348 Q--------IGIMSF--GSDNCGGLRIPSVYTSVAHFSEWI 378
            .        .|::|.  .:|.|.  ...:|.|::.||.:.|
  Fly   578 TWNTARHFLFGVISNAPNADQCA--HSLTVMTNIQHFEDMI 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 67/272 (25%)
Tryp_SPc 138..378 CDD:214473 66/270 (24%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056 3/32 (9%)
Sushi 309..354 CDD:278512 11/53 (21%)
Tryp_SPc 371..616 CDD:214473 66/270 (24%)
Tryp_SPc 371..591 CDD:304450 59/243 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.