DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG3505

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:397 Identity:114/397 - (28%)
Similarity:174/397 - (43%) Gaps:78/397 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GEFEKLLVPVSHGSAEQRSGAR-----------SNETTGHSVAAR--SYYDVVQNAGQTGCSVGT 73
            |.|..|||.|  ||....:.|:           |...|||.::.|  .|:..:..:|....|   
  Fly     2 GSFPALLVVV--GSLALGANAQLPPINCVAKIPSGRVTGHCISIRECDYFMRILLSGNLSQS--- 61

  Fly    74 ECTPLHDCTALIYEVARSCYYGDKSL----YCGGSSEELPYVCCPSS--------PLEKNQVCGK 126
                                  |::|    .||....:: .|||||:        ||..:. |||
  Fly    62 ----------------------DRNLLRDNQCGVRGNDV-QVCCPSTAGLGALTHPLLPSD-CGK 102

  Fly   127 SLVQ--GHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHC-ALAKADGHRLSS 188
            ...|  ......:..:|::|.|.:...|.... :.|.|.:|:.|.:|||||| |.|.....::::
  Fly   103 VRWQRSNDTDTRIREFPWLALIEYTRGNQEKI-HACGGVLISDRYVLTAAHCVAQAATSNLQITA 166

  Fly   189 VRVGEYDTSSDPDC-----ANTGFCAPRSVNHAISHVIVHPDYKQGQ--YHHDIALLVLKTPLNY 246
            ||:||:|||::|||     :....|||...:.||..::.||.|.:..  ..:||||:.|.:|...
  Fly   167 VRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKL 231

  Fly   247 SVATQPICL--QKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGAL 309
            :...|||||  ::.||:.:......:|||...|:..:|:..     |.::|.:.|.|.|.|    
  Fly   232 NDFVQPICLPNKQLRADELEDLVTEVAGWQASSSQRMRKGY-----VTISSIEECQRKYAS---- 287

  Fly   310 ESPNSIEGQWMCAGGEGKDVCQGFGGAPLFIQENGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHF 374
             ....|:...:| |......|.|..|.||.:.:|..:...|::|||...|.....|.|||.||.:
  Fly   288 -QQLRIQASKLC-GLTNSQECYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASY 350

  Fly   375 SEWIHDN 381
            .:||||:
  Fly   351 IDWIHDS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 81/252 (32%)
Tryp_SPc 138..378 CDD:214473 78/249 (31%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855 13/77 (17%)
Tryp_SPc 111..356 CDD:238113 80/256 (31%)
Tryp_SPc 111..354 CDD:214473 78/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.