DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG14088

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:237 Identity:50/237 - (21%)
Similarity:83/237 - (35%) Gaps:68/237 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 GAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDY 226
            |.:|..|.|||..||    .|...:...|:|||....          :..:.:|.::....:.::
  Fly    60 GTLIHERFILTDVHC----GDSIGVIRARLGEYGRIG----------SELAEDHIVAAFFSNANF 110

  Fly   227 KQGQYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDV 291
            ......:::.|:.|...:.|.....|:|:      |:..:..|.|            .|:.:.:.
  Fly   111 NPETQANNMGLMKLLRTVVYKEHIIPVCI------LMDSRMQTFA------------DELDYFNG 157

  Fly   292 PLTSWDLCLRNYGSTGALESPNSI----------EGQWMCAGGEGKDVCQGFGGAPL-----FIQ 341
              |:|    :|...:..|.|...|          .||: |||.:..|.|....||.|     :|.
  Fly   158 --TTW----KNSDKSPMLRSKTVIRMPQACGKLDHGQF-CAGHKDLDSCDEPSGAALTREIDYIG 215

  Fly   342 EN-----GIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378
            .|     ||.:.:.:      .|...|   .||.|....:||
  Fly   216 PNRTVLFGIANSVEV------KCSNSR---TYTDVVQLHQWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 50/237 (21%)
Tryp_SPc 138..378 CDD:214473 48/235 (20%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 50/237 (21%)
Tryp_SPc 42..248 CDD:214473 48/235 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.