DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and Jon74E

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:296 Identity:70/296 - (23%)
Similarity:111/296 - (37%) Gaps:87/296 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 VCGKS---LVQGHFYKGLG------------SYPFVARIGFKHVNTGAFAYPCAGAVIARRVILT 172
            |.|:|   |..||   |:|            .:|:...:..:..| ..:.: |..::|:.|.:||
  Fly    14 VQGRSISCLDMGH---GIGGRIAGGELARANQFPYQVGLSIEEPN-DMYCW-CGASLISDRYLLT 73

  Fly   173 AAHCA-LAKADGHRLSSV-RVGEYDTSSDPDCANTGFCAPRSVNHAIS-HVIVHPDYKQGQYHHD 234
            ||||. .|.|..:.|..| |:                 |||.:..:.: .|.:|||:......:|
  Fly    74 AAHCVEKAVAITYYLGGVLRL-----------------APRQLIRSTNPEVHLHPDWNCQSLEND 121

  Fly   235 IALLVLKTPLNYSVATQPICLQ--KTRANLVVGKRATIAGWGKMSTSSV---------------- 281
            |||:.|........:.:||.|.  .:..|......|..:|||:|:..|.                
  Fly   122 IALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESN 186

  Fly   282 RQPEMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAPLF----IQE 342
            ...|.|:.::..|  ::|:...|                     ||..|.|..|.||.    :|.
  Fly   187 EDCEYSYANIKPT--NICMDTTG---------------------GKSTCTGDSGGPLVYSDPVQN 228

  Fly   343 NGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378
            ..|.  ||:.|:|..:......|||:|.:..:.:||
  Fly   229 ADIL--IGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 63/278 (23%)
Tryp_SPc 138..378 CDD:214473 61/276 (22%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 60/274 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.