DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG3088

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:293 Identity:65/293 - (22%)
Similarity:113/293 - (38%) Gaps:63/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SLYCGGS----SEELPYVCCPSSPLEKNQVCGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAY 158
            :|...||    ||:..::....||..:.|.                 |:|..:.|...|..    
  Fly    11 TLVAAGSAKKDSEDPDHIITNGSPAYEGQA-----------------PYVVGMAFGQSNIW---- 54

  Fly   159 PCAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVH 223
             |:|.:|....|||:|.| |..:.|       |..|            |.|.|......:..:..
  Fly    55 -CSGTIIGDTWILTSAQC-LTGSSG-------VTIY------------FGATRLSQAQFTVTVGT 98

  Fly   224 PDYKQGQYHHDIALLVLKTP-LNYSVATQPICLQ--KTRANLVVGKRATIAGWGKMSTSSVRQPE 285
            .:|..|..|    |.:::.| :.:|.....:.|.  :.|:.......|.:.|||..:.|:.....
  Fly    99 SEYVTGNQH----LALVRVPRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDA 159

  Fly   286 MSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCA-GGEGKDVCQGFGGAPLFIQENGIFSQI 349
            :..:|:.:.|.:.|:..||||       ::..|.:|. ...|:..|.|..|:||..:::.  :.:
  Fly   160 LQCVDLQIMSNNECIAFYGST-------TVSDQILCTRTPSGRSTCFGDAGSPLITKQDS--TVV 215

  Fly   350 GIMSFGSDNCGGLRIPSVYTSVAHFSEWIHDNT 382
            ||.:|.:.|...|.:|:.:..:....:|||..|
  Fly   216 GISAFVASNGCTLGLPAGFARITSALDWIHQRT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 56/246 (23%)
Tryp_SPc 138..378 CDD:214473 53/243 (22%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 58/271 (21%)
Tryp_SPc 29..244 CDD:214473 56/269 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.