DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG33460

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:276 Identity:64/276 - (23%)
Similarity:100/276 - (36%) Gaps:74/276 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSS 188
            ||  |::..|...||  |:.|.:   |.:...|   |||.:|....|||||.|....|     ..
  Fly    31 CG--LMREEFSTSLG--PWTALL---HTDGSIF---CAGTLITDVFILTAASCIRPNA-----VK 80

  Fly   189 VRVGEYDTSSD--PDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQ 251
            ||:||:....:  |:            :|.:.:.:::..:......::|.||.|...:..:....
  Fly    81 VRLGEFGRYPNELPE------------DHLVHYFLMYRLFNNESLANNIGLLKLTKRVQITDYIM 133

  Fly   252 PICLQKTRANLVVGKRATIA-GWGKMSTSSV----------RQPEMSHLDVPLTSWDLCLRNYGS 305
            |:|:.....|..:.....|. .|.:.|..|:          .:|:|      .|:.||..:    
  Fly   134 PVCIVLNPQNQQLSTMRFIGNAWMEDSNVSLTKELRPIVIQSKPKM------CTNLDLYTQ---- 188

  Fly   306 TGALESPNSIEGQWMCAGGEGK-DVCQGFGGAPLFIQENGIFS-----QIGIMSFGSDNCGGLRI 364
                          .|||.:|. ..|.|..|:.| ||.:...:     |.||.:....:|   ..
  Fly   189 --------------FCAGHQGNLRSCDGLTGSAL-IQNSRYMNKYRHIQFGIATVNDMDC---EE 235

  Fly   365 PSVYTSVAHFSEWIHD 380
            ...||.|..|..||.|
  Fly   236 SQGYTDVLKFYWWIQD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 59/262 (23%)
Tryp_SPc 138..378 CDD:214473 56/258 (22%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 58/259 (22%)
Tryp_SPc 44..249 CDD:214473 55/255 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.