DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG10472

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:294 Identity:74/294 - (25%)
Similarity:125/294 - (42%) Gaps:69/294 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SPLEKNQVCGKSLVQGHFYKGLGSYP--FVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCAL 178
            :|:.|  |.|::|..|....|..:.|  |..::|.....||..|: |.|.:|:.|.|:|||||..
  Fly    32 TPMPK--VHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGGAAW-CGGTIISDRWIITAAHCTD 93

  Fly   179 AKADGHRLSSVRVGEYD-TSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKT 242
            :...|   ..|.:|.:| |::..:.....|...:       :||||.|:......:||:|:.|..
  Fly    94 SLTTG---VDVYLGAHDRTNAKEEGQQIIFVETK-------NVIVHEDWIAETITNDISLIKLPV 148

  Fly   243 PLNYSVATQPICLQKTRANLVV---------GKRATIAGWGKMSTSSVRQPE-MSHLDVPL---- 293
            |:.::...||       |.|.|         |:.|..:||||:|.|:....: :.:..||:    
  Fly   149 PIEFNKYIQP-------AKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNS 206

  Fly   294 --TSW--------DLCLRNYGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAPLFIQENGIFSQ 348
              :.|        ::|::..|                     |...|.|..|.|| :.::|..:.
  Fly   207 GCSPWYFGLVAASNICIKTTG---------------------GISTCNGDSGGPL-VLDDGSNTL 249

  Fly   349 IGIMSFGSDNCGGLRIPSVYTSVAHFSEWIHDNT 382
            ||..|||......:..|.|:|.:.::.:||.:.:
  Fly   250 IGATSFGIALGCEVGWPGVFTRITYYLDWIEEKS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 67/269 (25%)
Tryp_SPc 138..378 CDD:214473 65/266 (24%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 66/272 (24%)
Tryp_SPc 47..282 CDD:238113 68/274 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.