DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and yip7

DIOPT Version :10

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:33 Identity:10/33 - (30%)
Similarity:15/33 - (45%) Gaps:6/33 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 DNYIPANPMSTPPHIVPEWYFLPIYAILRSIPD 293
            |:.:|..|...||.  ||    |..:|:..:.|
  Fly     5 DDMLPFTPSWFPPS--PE----PFPSIMELLQD 31

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 10/33 (30%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.