DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and yip7

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:269 Identity:62/269 - (23%)
Similarity:112/269 - (41%) Gaps:54/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSV 189
            ||..|.|.|       |:...:.|   ::.|.::.|.|::|....:||||||    .||....::
  Fly    43 GKDAVAGQF-------PYQVGLSF---SSSAGSWWCGGSIIGNEWVLTAAHC----TDGAASVTI 93

  Fly   190 RVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYH------HDIALLVLKTPLNYSV 248
            ..|. ...:.|:               .:.|:....::|.:.:      :||: |:..:.:::|.
  Fly    94 YYGA-TVRTSPE---------------FTQVVSSSKFRQHESYLALTIRNDIS-LIQTSSVSFSA 141

  Fly   249 ATQPICLQ--KTRANLVVGKRATIAGWGKMSTSSVR-QPEMSHLDVPLTSWDLCLRNYGSTGALE 310
            ....|.|.  ....:...||.|..:|||..|..:.. ..::.::|:.:.|...|...:||.    
  Fly   142 TVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSL---- 202

  Fly   311 SPNSIEGQWMCAGGEGK-DVCQGFGGAPLFIQENGIFSQIGIMSFGS-DNCGGLRIPSVYTSVAH 373
               .:..:.:|.....| ..|||..|.||.:  :|:.  ||..|||| |.|.. ..|:.:|.:.:
  Fly   203 ---IVTSRVLCVDTTNKASTCQGDSGGPLAL--DGVL--IGATSFGSADGCES-GAPAAFTRITY 259

  Fly   374 FSEWIHDNT 382
            :.:||.:.:
  Fly   260 YRDWIKETS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 57/253 (23%)
Tryp_SPc 138..378 CDD:214473 55/250 (22%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 60/263 (23%)
Tryp_SPc 40..267 CDD:238113 62/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.