DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG10477

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:283 Identity:70/283 - (24%)
Similarity:117/283 - (41%) Gaps:52/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PSSPLEKNQVCGKSLVQGHFYKG----LGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAA 174
            |..|.:.:.|   ..:.|....|    ...:|:...:.||   :.|.::.|.|::||...:||||
  Fly    24 PVHPRDSSAV---PSIDGRITNGNKAAANQFPYQVGLSFK---SSAGSWWCGGSIIANTWVLTAA 82

  Fly   175 HCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLV 239
            ||...      .|||.:  |..|:    ..|.....:.|:.  |..:.|..|......:||:|  
  Fly    83 HCTKG------ASSVTI--YYGST----VRTSAKLKKKVSS--SKFVQHAGYNAATLRNDISL-- 131

  Fly   240 LKTP-LNYSVATQPICLQKTRA--NLVVGKRATIAGWGKMSTSSVR-QPEMSHLDVPLTSWDLCL 300
            :||| :.::|:...|.|....:  :...|:.|..:|||:.|.||:. ...:.:....:.:..:|.
  Fly   132 IKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQ 196

  Fly   301 RNYGS----TGAL--ESPNSIEGQWMCAGGEGKDVCQGFGGAPLFIQENGIFSQIGIMSFGSDNC 359
            :.:||    :|.:  ||.|.            |..|||..|.||.:...    .||:.||.|...
  Fly   197 KTFGSSVVTSGVICVESINK------------KSTCQGDSGGPLALNNR----LIGVTSFVSSKG 245

  Fly   360 GGLRIPSVYTSVAHFSEWIHDNT 382
            .....|:.:|.|..:.:||.:.:
  Fly   246 CEKNAPAGFTRVTSYLDWIKNQS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 65/252 (26%)
Tryp_SPc 138..378 CDD:214473 63/249 (25%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 64/259 (25%)
Tryp_SPc 40..267 CDD:238113 66/261 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.