DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG15873

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:235 Identity:62/235 - (26%)
Similarity:105/235 - (44%) Gaps:52/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 CAGAVIARRVILTAAHCALAKADGHRLSS------------VRVGEYDTSSDPDCANTGFCAPRS 212
            |:|.:::.|.:||||||.   .|.::.|.            .|:..||.|..           ||
  Fly    69 CSGVLVSSRAVLTAAHCL---TDRYKASMNPRGIRVVFGHITRLAVYDESDF-----------RS 119

  Fly   213 VNHAISHVIVHPDYKQGQYHHDIALLVLKTPL---NYSVATQPICLQKTRANLVVGKRATIAGWG 274
            |:    .::|||:|::.: .:|:|:|.|...:   |:.|.  |:.::|| ||:..|......|||
  Fly   120 VD----RLVVHPEYERYK-KNDLAILRLSERVQSSNHDVL--PLLMRKT-ANVTYGDTCITLGWG 176

  Fly   275 KMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGGEGKDV-CQGFGGAPL 338
            ::........|:.:|||.|....||.::|.:..|..:        :|....|:.: |.|..|.||
  Fly   177 QIYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHN--------VCTEPVGESMNCAGDMGGPL 233

  Fly   339 FIQENGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378
             :.:..:|..||    |...|.|.:... :.|..::.:||
  Fly   234 -LCKGALFGLIG----GHMGCAGGKAMK-FLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 62/235 (26%)
Tryp_SPc 138..378 CDD:214473 60/233 (26%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 57/215 (27%)
Tryp_SPc 59..250 CDD:238113 57/215 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.