DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG30283

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:292 Identity:81/292 - (27%)
Similarity:122/292 - (41%) Gaps:70/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GSSEELPYVCCPSSPLEKNQVCGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIAR 167
            ||..|.|   |.:.|:.:.::.|     || ...:.|.|::|.:      .|...:.|.|.:|..
  Fly    26 GSFLEHP---CGTVPISQFKILG-----GH-NAPVASAPWMAMV------MGEGGFHCGGTLITN 75

  Fly   168 RVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYH 232
            |.:||:|||.   |:|.  ..||:|..:..::            :...|:..:.||.||...|  
  Fly    76 RFVLTSAHCI---ANGE--LKVRLGVLEREAE------------AQKFAVDAMFVHTDYYFDQ-- 121

  Fly   233 HDIALLVLKTPLNYSVATQPIC-----LQKTRANLVVGKRATIAGWGKM-STSSVRQPEMSHLDV 291
            ||:|||.|...::||....|||     |.|.....:|..|.  .||||. |.||.|..:.:.|  
  Fly   122 HDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRT--YGWGKTESRSSSRMLQKTSL-- 182

  Fly   292 PLTSWDL----CLRNYGSTGALESPN-SIEGQWMCAGGEGKDVCQGFGGAPL-----FIQENGIF 346
                ::|    |.:.|        |: .|....:||.....:.|.|..|.||     :.....:|
  Fly   183 ----FNLHRSECAKQY--------PHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVF 235

  Fly   347 SQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378
             |.|:.|||..:|..   .:|:|:|....:||
  Fly   236 -QFGVTSFGHADCSK---ATVFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 72/257 (28%)
Tryp_SPc 138..378 CDD:214473 70/255 (27%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 73/271 (27%)
Tryp_SPc 43..266 CDD:238113 75/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.