DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG10764

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:238 Identity:66/238 - (27%)
Similarity:102/238 - (42%) Gaps:55/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 YPCAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIV 222
            :.|.|.:|..|.:|:||||.:...|.:    ||:|..:.:.           |.:| |.:.:|.|
  Fly    61 FQCGGTIIHMRFVLSAAHCLVRGYDLY----VRLGARNINE-----------PAAV-HTVINVFV 109

  Fly   223 HPDYKQGQYHHDIALLVLKTPLNYSVATQPICL---QKTRANLVVGKRATIAGWGKMSTSSVRQP 284
            |.|:...:|.:||.||.|...:.|:|..||||:   ...:.::...|.....|||..:       
  Fly   110 HHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRN------- 167

  Fly   285 EMSHLDVPLTSWDL-------CLR--NYGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAP--- 337
              ..|.:.|.:..|       |.|  |:          ::..:.:|||.:..|.|:|..|.|   
  Fly   168 --GKLSIMLQTIYLLHLKRNECKRKLNF----------NLNSRQICAGTKNGDTCRGDSGGPLST 220

  Fly   338 --LFIQENGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378
              ||........|:||:|||...|.|:   .|||.|..:.:||
  Fly   221 NILFPSNKSYEVQLGIVSFGDPECRGV---GVYTDVTSYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 66/238 (28%)
Tryp_SPc 138..378 CDD:214473 64/236 (27%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 64/236 (27%)
Tryp_SPc 38..263 CDD:238113 66/238 (28%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.