DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and scaf

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:193 Identity:51/193 - (26%)
Similarity:85/193 - (44%) Gaps:36/193 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 CAGAVIARRVILTAAHCALAKADGHRLSSVRV--GEYDTSSDPDCANTGFCAPRSVNHAISHVIV 222
            |.||:|..:.:|::|.|    .:|..::.:||  ||::..|      |....|..:. .:..|.|
  Fly   450 CGGAIIGDQFVLSSASC----VNGLPVTDIRVKAGEWELGS------TNEPLPFQLT-GVKTVDV 503

  Fly   223 HPDYKQGQYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIAGWGKMSTSSVRQPEMS 287
            ||||......||:|::.|:..|.::...||||:......  ..::...:||||.:.|...:..:.
  Fly   504 HPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPK--DSEQCFTSGWGKQALSIHEEGALM 566

  Fly   288 HLDVPL-----------------TSWDLCLRNYGSTGALESPNSIEGQWMCAG----GEGKDV 329
            |:...|                 |.:|.|..:.||..|..|.:|:..:.:.||    |||:.|
  Fly   567 HVTDTLPQARSECSADSSSVCSATKFDSCQFDVGSALACGSGSSVRLKGIFAGENSCGEGQTV 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 51/193 (26%)
Tryp_SPc 138..378 CDD:214473 51/193 (26%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 45/178 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.