DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG4650

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:275 Identity:71/275 - (25%)
Similarity:108/275 - (39%) Gaps:64/275 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSS 188
            || .|..|.....:.| |::|     :::|....|.|.|.||..:::||||||..|...    ..
  Fly    28 CG-LLTNGKIANNISS-PWMA-----YLHTSELLYVCGGTVITEKLVLTAAHCTRASEQ----LV 81

  Fly   189 VRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPI 253
            .|:||:..:.|   ||....:    .:.:|...:|..|......:|||:|.|.|.:.:|...:||
  Fly    82 ARIGEFIGTDD---ANDTMLS----EYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPI 139

  Fly   254 CL------QKTRANLVVGKRATIAGWGKMS----------TSSVRQPEMSHLDVPLTSWDLCLRN 302
            |:      :|...|:.|   .:.|.||..:          |...|||.           ::| ..
  Fly   140 CIVWWTIWRKYIDNIQV---LSGAQWGLPNDRNESDAFRITDIRRQPA-----------NMC-ST 189

  Fly   303 YGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAPL--FIQENGI--FSQIGIMSFGSDNCGGLR 363
            ...|..|.|.       .|||.....:|.....:||  .|....|  :..|||.: .:..|   :
  Fly   190 LNGTAILSSQ-------FCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT-TNQKC---K 243

  Fly   364 IPSVYTSVAHFSEWI 378
            ..||||.|...:::|
  Fly   244 RASVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 67/261 (26%)
Tryp_SPc 138..378 CDD:214473 66/259 (25%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 67/267 (25%)
Tryp_SPc 33..258 CDD:304450 67/267 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.