DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:280 Identity:75/280 - (26%)
Similarity:116/280 - (41%) Gaps:58/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QVCGKSL-----VQGHFYKGLGSY----PFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCA 177
            ||..|.|     :.|....|..:|    |:...:||    :|...:.|.|::||...:|||||| 
  Fly    21 QVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGF----SGNGGWWCGGSIIAHDWVLTAAHC- 80

  Fly   178 LAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQ-----GQYHHDIAL 237
               .:|....::..|                |....|...:|.:...|:.|     .|..:||||
  Fly    81 ---TNGASQVTIYYG----------------ATWRTNAQFTHTVGSGDFIQNHNWPNQNGNDIAL 126

  Fly   238 LVLKTP-LNYSVATQPICLQ--KTRANLVVGKRATIAGWGKMSTSSVRQPE-MSHLDVPLTSWDL 298
              ::|| :::......:.|.  ..|.|:.....|...|||..:..|  ||: |..:|:.:.|...
  Fly   127 --IRTPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGS--QPDWMECVDLQIISNSE 187

  Fly   299 CLRNYGSTGALESPNSIEGQWMCAG-GEGKDVCQGFGGAPLFIQENGIFSQIGIMSFGSDNCGGL 362
            |.|.||:     .|:.|    :|.. ..||..|.|..|.||.:.:.|  ..:|:.|:.|.|....
  Fly   188 CSRTYGT-----QPDGI----LCVSTSGGKSTCSGDSGGPLVLHDGG--RLVGVTSWVSGNGCTA 241

  Fly   363 RIPSVYTSVAHFSEWIHDNT 382
            .:||.:|.|.:..:||.||:
  Fly   242 GLPSGFTRVTNQLDWIRDNS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 67/256 (26%)
Tryp_SPc 138..378 CDD:214473 65/253 (26%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 66/259 (25%)
Tryp_SPc 37..260 CDD:238113 68/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.