DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:262 Identity:60/262 - (22%)
Similarity:98/262 - (37%) Gaps:48/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VQGHFYKGL----GSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSV 189
            ::|....|.    |..|:...:||      :..:.|.|::||...:|||.||             
  Fly    33 IEGRITNGYAAPEGKAPYTVGLGF------SGGWWCGGSIIAHDWVLTAEHC------------- 78

  Fly   190 RVGEYDTSSDPDCAN--TGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALL-VLKTPLNYSVATQ 251
             :|        |.|:  ..|.|....|...:|.:.:.::.: ..:.||||: :......:.|...
  Fly    79 -IG--------DAASVIVYFGATWRTNAQFTHTVGNGNFIK-HSNADIALIRIPHVDFWHMVNKV 133

  Fly   252 PICLQKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESPNSIE 316
            .:.....|.|......|...|||.....|.....:..:|:.:...:.|...|||.|    .|.| 
  Fly   134 ELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYGSVG----DNVI- 193

  Fly   317 GQWMCAGG-EGKDVCQGFGGAPLFIQENGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWIHD 380
                |... :||.:|.|..|.||...:..  ..:|:.:|.|.|......|:.:..|.:..:||.|
  Fly   194 ----CTRTVDGKSICGGDSGGPLVTHDGS--KLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIRD 252

  Fly   381 NT 382
            :|
  Fly   253 HT 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 56/246 (23%)
Tryp_SPc 138..378 CDD:214473 54/243 (22%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 55/253 (22%)
Tryp_SPc 37..253 CDD:238113 57/255 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.