DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and psh

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:353 Identity:91/353 - (25%)
Similarity:146/353 - (41%) Gaps:64/353 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CSVGT----ECTPLHDC--TALIYEVARSCYYGDKS-LYCG-------GSSEELPYVCCPSSPLE 119
            |.:|.    .|.|...|  .:.|..|:.|.....|: :..|       ||.:......|......
  Fly    67 CGLGAWGEIFCCPTKPCCDNSTITSVSTSSTTSTKAPMTSGRVDVPTFGSGDRPAVAACKKIRER 131

  Fly   120 KNQVCGKSLVQGHFYKGL----GSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAK 180
            |.|..|..||. |...|.    |.||.:|.||:....|.   :.|.|::||.|.:||||||  ..
  Fly   132 KQQRSGNQLVI-HIVGGYPVDPGVYPHMAAIGYITFGTD---FRCGGSLIASRFVLTAAHC--VN 190

  Fly   181 ADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVI-----VHPDYKQGQYHHDIALLVL 240
            .|.:..:.||:|..:. .:||             |:...::     :||.| .|..::|||:|.|
  Fly   191 TDANTPAFVRLGAVNI-ENPD-------------HSYQDIVIRSVKIHPQY-VGNKYNDIAILEL 240

  Fly   241 KTPLNYSVATQPICLQKTRANLVVGKRATIAGWGKMS-TSSVRQPEMSHLDVPLTSWDLCLRNYG 304
            :..:..:...:|.||.....:.....:..:||||.:: |:..|...:....:.|...|.|..:|.
  Fly   241 ERDVVETDNIRPACLHTDATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYA 305

  Fly   305 STGALESPNSIE-------GQWMCAGGEG--KDVCQGFGGAPLFIQ---ENGIFSQIGIMSFGSD 357
                 |.|.||.       ...:||..:.  .|.|:|..|.||..:   |:|:::.:|::|.|. 
  Fly   306 -----EQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGF- 364

  Fly   358 NCGGLRIPSVYTSVAHFSEWIHDNTPPE 385
            .|..: .|.:||.|:.:.::|.....|:
  Fly   365 GCATV-TPGLYTRVSSYLDFIEGIVWPD 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 70/260 (27%)
Tryp_SPc 138..378 CDD:214473 69/257 (27%)
pshNP_573297.1 CLIP 30..79 CDD:197829 3/11 (27%)
Tryp_SPc 143..384 CDD:214473 71/267 (27%)
Tryp_SPc 144..387 CDD:238113 71/269 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.