DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG8952

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:287 Identity:83/287 - (28%)
Similarity:132/287 - (45%) Gaps:50/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 PYVCCPSSPLEKNQVCGKSLVQGHFYKGLGSYPF---VARIGFKHVNTGAFAYPCAGAVIARRVI 170
            |:....|||::    ....:|.|...| ||.:|:   :.|..:..:       .|.|::|:...:
  Fly    23 PFDPANSSPIK----IDNRIVSGSDAK-LGQFPWQVILKRDAWDDL-------LCGGSIISDTWV 75

  Fly   171 LTAAHCALAKADGHRLSSV--RVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHH 233
            ||||||.      :.|||:  ..|..|..:    ||       ::|...:::|:||||.. :.::
  Fly    76 LTAAHCT------NGLSSIFLMFGTVDLFN----AN-------ALNMTSNNIIIHPDYND-KLNN 122

  Fly   234 DIALLVLKTPLNYSVATQPICLQKTRANLV--VGKRATIAGWGKMSTSSVRQPE-MSHLDVPLTS 295
            |::|:.|..||.:|...|.|.|.....:.:  ||..|||||:|......:...| :.:..|.:..
  Fly   123 DVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIID 187

  Fly   296 WDLCLRNYGSTGALESPNSIEGQWMCAGG-EGKDV--CQGFGGAPLFIQENGI--FSQIGIMSFG 355
            ...|:..||....::|.       |||.| :|.|:  |.|..|.||.:....|  :.||||.||.
  Fly   188 NADCVAIYGKYVVVDST-------MCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFV 245

  Fly   356 SDNCGGLRIPSVYTSVAHFSEWIHDNT 382
            :::....|:||.|..|:.|..:|.|.|
  Fly   246 AEDQCTYRLPSGYARVSSFLGFIADKT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 73/255 (29%)
Tryp_SPc 138..378 CDD:214473 72/252 (29%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 76/263 (29%)
Tryp_SPc 38..271 CDD:238113 77/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.